DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nau and Myog

DIOPT Version :9

Sequence 1:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_112466.1 Gene:Myog / 17928 MGIID:97276 Length:224 Species:Mus musculus


Alignment Length:227 Identity:86/227 - (37%)
Similarity:110/227 - (48%) Gaps:61/227 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YSHANHNPVELD--KPLG-----MNMTP---SPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSR 143
            |...|:.||.|.  :|.|     ::::|   .|:       |...|.:.||      |..     
Mouse    17 YDGENYLPVHLQGFEPPGYERTELSLSPEARGPL-------EEKGLGTPEH------CPG----- 63

  Fly   144 PCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEY 208
            .||.||||.||:|||:||||:|||:||:|||:|||||||.|||.|..|||||||||||||:||:|
Mouse    64 QCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQY 128

  Fly   209 IESLEDLL----QESSTT--RDGDNLAPSLSGKSCQSDYLSSYAGAYLEDKLSFYNKHMEKYGQF 267
            ||.|:.||    ||....  |.|....|.:..: |.|...|.                ..::|..
Mouse   129 IERLQALLSSLNQEERDLRYRGGGGPQPMVPSE-CNSHSASC----------------SPEWGNA 176

  Fly   268 TDFDGN----------ANGSSLDCLNLIVQSI 289
            .:|..|          .:..:|..|..||.||
Mouse   177 LEFGPNPGDHLLAADPTDAHNLHSLTSIVDSI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 29/86 (34%)
HLH 162..213 CDD:278439 39/50 (78%)
MyogNP_112466.1 BASIC 1..86 CDD:128794 29/86 (34%)
HLH 82..133 CDD:306515 39/50 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849411
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.