DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nau and Myog

Sequence 1:NP_476650.1 Gene:nau FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_112466.1 Gene:Myog MGIID:97276 Length:224 Species:Mus musculus

Alignment Length:227 Identity:86/228 (38%)
Similarity:110/228 (48%) Gaps:61/228 (27%)


  Fly    89 YSHANHNPVELD--KPLG-----MNMTP---SPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSR 143
            |...|:.||.|.  :|.|     ::::|   .|:       |...|.:.||      |..     
Mouse    17 YDGENYLPVHLQGFEPPGYERTELSLSPEARGPL-------EEKGLGTPEH------CPG----- 63

  Fly   144 PCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEY 208
            .||.||||.||:|||:||||:|||:||:|||:|||||||.|||.|..|||||||||||||:||:|
Mouse    64 QCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQY 128

  Fly   209 IESLEDLL----QESSTT--RDGDNLAPSLSGKSCQSDYLSSYAGAYLEDKLSFYNKHMEKYGQF 267
            ||.|:.||    ||....  |.|....|.:..: |.|...|.                ..::|..
Mouse   129 IERLQALLSSLNQEERDLRYRGGGGPQPMVPSE-CNSHSASC----------------SPEWGNA 176

  Fly   268 TDFDGN----------ANGSSLDCLNLIVQSI 289
            .:|..|          .:..:|..|..||.||
Mouse   177 LEFGPNPGDHLLAADPTDAHNLHSLTSIVDSI 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 30/87 (34%)
HLH 162..213 CDD:278439 40/51 (78%)
MyogNP_112466.1 BASIC 1..86 CDD:128794 30/87 (34%)
HLH 82..133 CDD:306515 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16381911
eggNOG 1 0.900 E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11534
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2661
TreeFam 1 0.960
76.830

Return to query results.
Submit another query.