DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: nau and Myf5

Sequence 1:NP_476650.1 Gene:nau FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_032682.1 Gene:Myf5 MGIID:97252 Length:255 Species:Mus musculus

Alignment Length:219 Identity:97/220 (44%)
Similarity:118/220 (54%) Gaps:47/220 (21%)


  Fly   127 EEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSN 191
            ||||.||   :....:..||.|||||||:||.|:||||||||||||||:|||:|||.|||.|::|
Mouse    52 EEHVRAP---TGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTN 113

  Fly   192 PNQRLPKVEILRNAIEYIESLEDLLQE-----------------SSTTRDGDNL----APSLSGK 235
            |||||||||||||||.|||||::||:|                 |.|:...|.:    :|..|.|
Mouse   114 PNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRK 178

  Fly   236 SCQSD--YLSSYAGAYLEDKLSFYNKHMEKYGQFTDFDGNANGSSLDCLNLIVQSINKSTTSPIQ 298
            :...|  |....:.|...||.|.                    ||||||:.||..|..:..|.:.
Mouse   179 NSSFDSIYCPDVSNACAADKSSV--------------------SSLDCLSSIVDRITSTEPSELA 223

  Fly   299 NKATPSASDTQSPPSSGAT-APTS 321
            .:.|.|.|...|..|..|| .|:|
Mouse   224 LQDTASLSPATSANSQPATPGPSS 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 23/39 (59%)
HLH 162..213 CDD:278439 44/51 (86%)
Myf5NP_032682.1 BASIC 1..88 CDD:128794 23/39 (59%)
HLH 84..135 CDD:278439 44/51 (86%)
Myf5 143..214 CDD:289036 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16380115
eggNOG 1 0.900 E1_KOG3960
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4411
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000646
OrthoInspector 1 1.000 T615661
orthoMCL 1 0.900 OOG5_137851
Panther 1 1.100 O PTHR11534
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2661
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.