DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and AT1G07080

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_563779.1 Gene:AT1G07080 AraportID:AT1G07080 Length:265 Species:Arabidopsis thaliana

Alignment Length:221 Identity:59/222 (27%)
Similarity:96/222 (43%) Gaps:34/222 (15%)


  Fly     5 VFVCLLL--------GWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRL 61
            |.||.:.        .:.||:.|     ..:.::::.||||:|||||..|:...| ..:...|.:
plant    11 VLVCYVFLFPFASSSDYSGVSLP-----SSSPKVSVGLYYESLCPYCSSFIVNHL-AKLFEDDLI 69

  Fly    62 PFTDLTLVPYGNARTNDDGNVE--CQHGVMECELNAWHACILE-HHDIAQSLKLIACMMR----G 119
            ...||.|.|:||.:...| ||.  ||||..||.|:...||.:: ...::.....|.|:.:    .
plant    70 SIVDLHLSPWGNTKLRSD-NVTAVCQHGAFECFLDTVEACAIDAWPKVSDHFPFIYCVEKLVTEH 133

  Fly   120 KKNRLEKCADHYQIDVGDVKNCKKTRQVNDILRKYGKETAKVS--FQGVPAVALDN--VYNADLS 180
            |.::.|.|.:...::...|.:|..:...|::...|..||..:.  .:.||.|.:|.  :|..   
plant   134 KYDKWETCYEKLNLNSKPVADCLSSGHGNELALHYAAETNALQPPHKYVPWVVVDGQPLYED--- 195

  Fly   181 ANLTDHFDAIFCAKYKEKFNKQLNNC 206
               .::|.:..|..||.  ||....|
plant   196 ---YENFISYICKAYKG--NKVPGAC 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 35/105 (33%)
AT1G07080NP_563779.1 GILT 40..144 CDD:308710 35/106 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D803513at2759
OrthoInspector 1 1.000 T32244
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13234
Phylome 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.