DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and OSH1

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_195778.1 Gene:OSH1 AraportID:AT5G01580 Length:233 Species:Arabidopsis thaliana

Alignment Length:177 Identity:61/178 (34%)
Similarity:95/178 (53%) Gaps:21/178 (12%)


  Fly     5 VFVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLV 69
            :|.|||          .|...|  ::.::||||||||:|.||:..:| |.:.....:...||.||
plant    14 IFFCLL----------SLSSSQ--KVTLSLYYEALCPFCAEFIVNRL-PKIFETGLISSIDLQLV 65

  Fly    70 PYGNARTNDDGNVECQHGVMECELNAWHACILE-HHDIAQSLKLIACMMR-GKKNRLEKCADHYQ 132
            |:|||....||.:.||||..||.|||.|||.:. :.|:.:....|.|..: ..:|:|||.||..:
plant    66 PWGNAAIRPDGTILCQHGEAECALNAIHACAINAYPDVMKHFGYIYCTEQLVLENKLEKWADCLE 130

  Fly   133 IDVG---DVKNCKKTRQVNDILRKYGKETAKV--SFQGVPAVALDNV 174
            : ||   ...:|......|.:.::|.:||:::  :.:.||.|.::|:
plant   131 M-VGLSRAAVDCYINGYGNQLEQRYAEETSELYPAHRFVPWVVVNNL 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 44/100 (44%)
OSH1NP_195778.1 GILT 29..130 CDD:281251 44/102 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D803513at2759
OrthoInspector 1 1.000 T32244
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.