DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and GILT

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001154228.1 Gene:GILT AraportID:AT4G12960 Length:243 Species:Arabidopsis thaliana

Alignment Length:215 Identity:69/216 (32%)
Similarity:90/216 (42%) Gaps:39/216 (18%)


  Fly     6 FVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVP 70
            |.||||    :.....|...::.::.:.||||:|||.|.||:...|. .:...|....|||.|.|
plant    12 FGCLLL----LTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLG-KIFDYDLYTITDLKLFP 71

  Fly    71 YGNARTNDDGNVECQHGVMECELNAWHACILE-----------HHDIAQSLKLIACMMRGKKNRL 124
            :|||..:|:..|.||||..||:|||..||.|.           :.........|.|:....|. .
plant    72 FGNAELSDNLTVTCQHGEEECKLNALEACALRTWPDQFDKCDGYGTQKSQYSFIRCVESDTKG-W 135

  Fly   125 EKCADHYQIDVGDVKNCKKTRQVN-----DILRK----YGKET--AKVSFQGVPAVALDNVYNAD 178
            |.|          |||..:.:.:|     |:.||    |..:|  .|...:.||.|.| |....|
plant   136 ESC----------VKNSGREKAINDCYNGDLSRKLILGYATKTKNLKPPHEYVPWVTL-NGKPLD 189

  Fly   179 LSANLTDHFDAIFCAKYKEK 198
            .|...||...|..|..||.|
plant   190 DSVQSTDDLVAQICNAYKGK 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 39/109 (36%)
GILTNP_001154228.1 GILT 33..141 CDD:281251 41/120 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D803513at2759
OrthoInspector 1 1.000 T32244
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.644 Consistency score
76.970

Return to query results.
Submit another query.