DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and AT4G12900

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_193026.1 Gene:AT4G12900 / 826902 AraportID:AT4G12900 Length:231 Species:Arabidopsis thaliana


Alignment Length:204 Identity:64/204 - (31%)
Similarity:92/204 - (45%) Gaps:29/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVP 70
            |.||||   ...:...|...::|::.:.||||:|||.|..|:...|. .:...|....|||.|:|
plant    16 FACLLL---FTFSSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHLG-KIFNTDLHTITDLKLIP 76

  Fly    71 YGNARTNDDGNVECQHGVMECELNAWHACILE-------HHDIAQSLKLIACMMRGKKNRLEKCA 128
            :|||..:||..|.||||..||:|||..||.:.       |:      |.|.| :....|..|.|.
plant    77 FGNAHVSDDLTVTCQHGEEECKLNALEACAIRTWPNQRLHY------KFIRC-VETNTNAWESCV 134

  Fly   129 DHYQIDVGD--VKNCKKTRQVNDILRKYGKET--AKVSFQGVPAVALDNVYNADLSANLTDHFDA 189
            ..|.   |:  :.:|.......:::..|..:|  .|...:.||.:.|:   ...|..|:.|..|.
plant   135 KKYG---GEKAINDCYNGDLSKELILGYANQTLSLKPEHKYVPWMTLN---GEPLYENIGDFVDL 193

  Fly   190 IFCAKYKEK 198
            : |..||.|
plant   194 V-CKAYKGK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 40/104 (38%)
AT4G12900NP_193026.1 GILT 38..137 CDD:367408 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.