DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and AT4G12900

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_193026.1 Gene:AT4G12900 AraportID:AT4G12900 Length:231 Species:Arabidopsis thaliana

Alignment Length:204 Identity:64/205 (31%)
Similarity:92/205 (45%) Gaps:29/205 (14%)


  Fly     6 FVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVP 70
            |.||||   ...:...|...::|::.:.||||:|||.|..|:...|. .:...|....|||.|:|
plant    16 FACLLL---FTFSSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHLG-KIFNTDLHTITDLKLIP 76

  Fly    71 YGNARTNDDGNVECQHGVMECELNAWHACILE-------HHDIAQSLKLIACMMRGKKNRLEKCA 128
            :|||..:||..|.||||..||:|||..||.:.       |:      |.|.| :....|..|.|.
plant    77 FGNAHVSDDLTVTCQHGEEECKLNALEACAIRTWPNQRLHY------KFIRC-VETNTNAWESCV 134

  Fly   129 DHYQIDVGD--VKNCKKTRQVNDILRKYGKET--AKVSFQGVPAVALDNVYNADLSANLTDHFDA 189
            ..|.   |:  :.:|.......:::..|..:|  .|...:.||.:.|:   ...|..|:.|..|.
plant   135 KKYG---GEKAINDCYNGDLSKELILGYANQTLSLKPEHKYVPWMTLN---GEPLYENIGDFVDL 193

  Fly   190 IFCAKYKEK 198
            : |..||.|
plant   194 V-CKAYKGK 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 40/105 (38%)
AT4G12900NP_193026.1 GILT 38..137 CDD:281251 40/107 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D803513at2759
OrthoInspector 1 1.000 T32244
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.644 Consistency score
76.970

Return to query results.
Submit another query.