DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and AT4G12890

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_567395.1 Gene:AT4G12890 AraportID:AT4G12890 Length:232 Species:Arabidopsis thaliana

Alignment Length:214 Identity:69/215 (32%)
Similarity:96/215 (45%) Gaps:42/215 (20%)


  Fly     5 VFVCLLLGWVGVAT--PRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLT 67
            :|.||.|..:.|.|  ...:....::::.|.||||:|||||..|:...|. .:...|.|..|||.
plant    12 LFPCLFLACLFVFTYSNNLVVAENSNKVKINLYYESLCPYCQNFIVDDLG-KIFDSDLLKITDLK 75

  Fly    68 LVPYGNARTNDDGNVECQHGVMECELNAWHAC-ILEHHDIAQSLKLIACMMRGKKNRLEKCADHY 131
            |||:|||..:::..:.||||..||:|||..|| |....|.....|.|.|:.: ..|..|.|    
plant    76 LVPFGNAHISNNLTITCQHGEEECKLNALEACGIRTLPDPKLQYKFIRCVEK-DTNEWESC---- 135

  Fly   132 QIDVGDVKNCKKTRQVND---------ILRKYGKETA--KVSFQGVPAVAL------DNVYNADL 179
                  ||...:.:.:||         ::..|.|.|:  |...:.||.|.|      ||.:|  |
plant   136 ------VKKSGREKAINDCYNGDLSQKLILGYAKLTSSLKPKHEYVPWVTLNGKPLYDNYHN--L 192

  Fly   180 SANLTDHFDAIFCAKYKEK 198
            .|.:        |..||.|
plant   193 VAQV--------CKAYKGK 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 42/99 (42%)
AT4G12890NP_567395.1 GILT 40..138 CDD:281251 44/110 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D803513at2759
OrthoInspector 1 1.000 T32244
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.644 Consistency score
76.970

Return to query results.
Submit another query.