DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and AT4G12890

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_567395.1 Gene:AT4G12890 / 826901 AraportID:AT4G12890 Length:232 Species:Arabidopsis thaliana


Alignment Length:214 Identity:69/214 - (32%)
Similarity:96/214 - (44%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFVCLLLGWVGVAT--PRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLT 67
            :|.||.|..:.|.|  ...:....::::.|.||||:|||||..|:...|. .:...|.|..|||.
plant    12 LFPCLFLACLFVFTYSNNLVVAENSNKVKINLYYESLCPYCQNFIVDDLG-KIFDSDLLKITDLK 75

  Fly    68 LVPYGNARTNDDGNVECQHGVMECELNAWHAC-ILEHHDIAQSLKLIACMMRGKKNRLEKCADHY 131
            |||:|||..:::..:.||||..||:|||..|| |....|.....|.|.|:.: ..|..|.|    
plant    76 LVPFGNAHISNNLTITCQHGEEECKLNALEACGIRTLPDPKLQYKFIRCVEK-DTNEWESC---- 135

  Fly   132 QIDVGDVKNCKKTRQVND---------ILRKYGKETA--KVSFQGVPAVAL------DNVYNADL 179
                  ||...:.:.:||         ::..|.|.|:  |...:.||.|.|      ||.:|  |
plant   136 ------VKKSGREKAINDCYNGDLSQKLILGYAKLTSSLKPKHEYVPWVTLNGKPLYDNYHN--L 192

  Fly   180 SANLTDHFDAIFCAKYKEK 198
            .|.:        |..||.|
plant   193 VAQV--------CKAYKGK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 42/98 (43%)
AT4G12890NP_567395.1 GILT 40..139 CDD:367408 44/110 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.