DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and AT4G12890

DIOPT Version :10

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_567395.1 Gene:AT4G12890 / 826901 AraportID:AT4G12890 Length:232 Species:Arabidopsis thaliana


Alignment Length:34 Identity:10/34 - (29%)
Similarity:17/34 - (50%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IGTLLQRGPKLNNVICKILGARSMSGMTKYLVEE 35
            ||.:....|..|.::.|:....|::..|.||.:|
plant   402 IGEMQLNRPDSNELLTKLSETSSINQQTTYLSKE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 33..128 CDD:460853 1/3 (33%)
AT4G12890NP_567395.1 GILT 43..137 CDD:460853
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.