DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and AT4G12870

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_193023.2 Gene:AT4G12870 AraportID:AT4G12870 Length:229 Species:Arabidopsis thaliana

Alignment Length:196 Identity:57/197 (29%)
Similarity:92/197 (47%) Gaps:13/197 (7%)


  Fly     6 FVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVP 70
            |.|.:|    .....:|...::|::.:.||||:|||.|..|:..:| ..:...|....||:.|||
plant    13 FACFVL----FTFSHKLVTGESDKVELNLYYESLCPGCQSFIVDEL-VKVFDSDLDTITDVKLVP 72

  Fly    71 YGNARTNDDGNVECQHGVMECELNAWHACILEHHDIAQS-LKLIACMMRGKKNRLEKCADHYQID 134
            :|.|:.:::..|.||||..||:|||..||::......:| .|.|.|:.....|....|...|..:
plant    73 FGYAKVSNNLTVICQHGEEECKLNALEACVINTLPNPKSQYKFIRCVENNTDNWESSCLKGYGNE 137

  Fly   135 VGDVKNCKKTRQVNDILRKYGKETA--KVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKE 197
            .. :.:|..:.....::..|.|:|:  |...:.||.|.::   :..|...|.|....: |..||.
plant   138 KA-INDCYNSDLSKKLILGYAKQTSSLKPKHEFVPWVTIN---SKPLYTKLDDLVGQV-CKAYKG 197

  Fly   198 K 198
            |
plant   198 K 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 36/99 (36%)
AT4G12870NP_193023.2 GILT 34..134 CDD:281251 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D803513at2759
OrthoInspector 1 1.000 T32244
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.644 Consistency score
76.970

Return to query results.
Submit another query.