DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and Ifi30

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_075552.2 Gene:Ifi30 MGIID:2137648 Length:248 Species:Mus musculus

Alignment Length:201 Identity:61/202 (30%)
Similarity:93/202 (46%) Gaps:29/202 (14%)


  Fly     7 VCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPS--MVRQDRLPFTDLTLV 69
            ||||       .||.|  |.:..:.::||||:||..|..|:...|.|:  ||    :...::|||
Mouse    45 VCLL-------GPRPL--PPSPPVRVSLYYESLCGACRYFLVRDLFPTWLMV----MEIMNITLV 96

  Fly    70 PYGNAR-TNDDGNVE--CQHGVMECELNAWHACILEHHDIAQSLKLIACM--MRGKKNRLEKCAD 129
            |||||: .|..|..|  ||||.:||.||...||:|:..:...:...|.||  |...:.:|..|..
Mouse    97 PYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQ 161

  Fly   130 HYQIDVG--DVKNCKKTRQVNDILRKYGKETAKV--SFQGVPAVALDNVYNADLSANLTDHFDAI 190
            .|..:|.  .:..|...::...::.:..:.|..:  ..:.||.|.::.....|.|..|     :|
Mouse   162 VYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELL-----SI 221

  Fly   191 FCAKYK 196
            .|..|:
Mouse   222 VCQLYQ 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 40/105 (38%)
Ifi30NP_075552.2 GILT 61..163 CDD:281251 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
TreeFam 1 0.960
65.890

Return to query results.
Submit another query.