DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and Ifi30

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_075552.2 Gene:Ifi30 / 65972 MGIID:2137648 Length:248 Species:Mus musculus


Alignment Length:201 Identity:61/201 - (30%)
Similarity:93/201 - (46%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPS--MVRQDRLPFTDLTLV 69
            ||||       .||.|  |.:..:.::||||:||..|..|:...|.|:  ||    :...::|||
Mouse    45 VCLL-------GPRPL--PPSPPVRVSLYYESLCGACRYFLVRDLFPTWLMV----MEIMNITLV 96

  Fly    70 PYGNAR-TNDDGNVE--CQHGVMECELNAWHACILEHHDIAQSLKLIACM--MRGKKNRLEKCAD 129
            |||||: .|..|..|  ||||.:||.||...||:|:..:...:...|.||  |...:.:|..|..
Mouse    97 PYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQ 161

  Fly   130 HYQIDVG--DVKNCKKTRQVNDILRKYGKETAKV--SFQGVPAVALDNVYNADLSANLTDHFDAI 190
            .|..:|.  .:..|...::...::.:..:.|..:  ..:.||.|.::.....|.|..|     :|
Mouse   162 VYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELL-----SI 221

  Fly   191 FCAKYK 196
            .|..|:
Mouse   222 VCQLYQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 40/104 (38%)
Ifi30NP_075552.2 GILT 61..163 CDD:281251 40/105 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.