DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and CG41378

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001163836.1 Gene:CG41378 FlyBaseID:FBgn0085638 Length:228 Species:Drosophila melanogaster

Alignment Length:182 Identity:56/183 (31%)
Similarity:93/183 (51%) Gaps:21/183 (11%)


  Fly     7 VCLLLG--W---VGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDL 66
            |||.:.  |   |.|.| .:|.|....::.:|:|||||||....|:|.||.|:.  :......::
  Fly    19 VCLFIVVLWYYPVPVLT-SQLHGGALMKVVVTVYYEALCPDSKYFLTKQLLPTF--KIAKSIMEV 80

  Fly    67 TLVPYGNARTND-DGNV--ECQHGVMECELNAWHACILE-HHDIAQSLKLIACMM---RGKKNRL 124
            .|.|||.|:|.: :|.:  :||||.:||:.|.:|||..| ..|....|::..||:   ...:..:
  Fly    81 KLAPYGKAKTKEHNGKITFDCQHGPIECQANIYHACAAEIIEDPLLRLEVATCMIMDNHSPQEAM 145

  Fly   125 EKCADHYQIDVGDVKNCKKTRQVNDILRKYGKET----AKVSFQGVPAVALD 172
            .||......|...::||.::.:..|:|:..|:.|    ..::|  :|.:.:|
  Fly   146 NKCTSQINFDDSVIQNCFESYRGVDLLKVIGESTNSLRPPITF--IPTITID 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 37/105 (35%)
CG41378NP_001163836.1 GILT 47..152 CDD:281251 37/107 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110992604
eggNOG 1 0.900 E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13234
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
54.970

Return to query results.
Submit another query.