DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and si:dkey-197i20.6

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_693944.2 Gene:si:dkey-197i20.6 ZFINID:ZDB-GENE-131127-557 Length:256 Species:Danio rerio

Alignment Length:188 Identity:49/189 (26%)
Similarity:83/189 (44%) Gaps:28/189 (15%)


  Fly    25 PQADRLAITLYYEALCPYCMEFVTTQLNPS-MVRQDRLPFTDLTLVPYGNAR-TNDDGNVECQHG 87
            |....:.|:||||:||..|..|:|.||.|: .:.:|   ...:.|||:|||: ..::.:..||||
Zfish    62 PVVPPVEISLYYESLCSGCRAFLTEQLFPTWTLLKD---IMKVNLVPFGNAKEVPEENSFSCQHG 123

  Fly    88 VMECELNAWHACILEHHDIAQSLKLIACMMRGKKNRLEKCADHYQ------------IDVGDVKN 140
            ..||..|...||:| :.....:..:|.||        |..||..|            |....:::
Zfish   124 EPECYANMVEACVL-YEATHAAFPVIHCM--------ESSADVTQSAKPCLQLYAPFIKWETIES 179

  Fly   141 CKKTRQVNDILRKYGKET--AKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYK 196
            |.:....:.::.:...:|  .|.:...||.:.::..|.::|..........:.|:.||
Zfish   180 CTRGELGHSLMHQNAVKTQALKPAHTHVPWITINGKYTSELEDKAMSTLFNLVCSLYK 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 36/100 (36%)
si:dkey-197i20.6XP_693944.2 SapA <33..54 CDD:295328
GILT 68..168 CDD:281251 37/112 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110992069
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.