DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and ifi30

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001017196.1 Gene:ifi30 XenbaseID:XB-GENE-1002315 Length:256 Species:Xenopus tropicalis

Alignment Length:188 Identity:58/189 (31%)
Similarity:87/189 (46%) Gaps:14/189 (7%)


  Fly    20 RRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNAR-TNDDGN-- 81
            |.|:......:.|.|:||:||..|..|:..||.||.:....:  .::||||||||: ||..|.  
 Frog    49 RDLKKSSEPAIQIDLFYESLCGGCRGFLVRQLFPSWLMLAEI--INVTLVPYGNAQETNITGKWV 111

  Fly    82 VECQHGVMECELNAWHACILEH--HDIAQSLKLIACMMRGKK--NRLEKCADHY--QIDVGDVKN 140
            .:||||..||..|...||:: |  .||.:...:|.||.....  ..||.|...|  ::.:..|..
 Frog   112 FDCQHGPEECLGNMMEACLI-HILDDIYKYFPIIFCMESSNNVTKSLESCLAVYAPELPLKTVLE 175

  Fly   141 CKKTRQVNDILRKYGKETAKVS--FQGVPAVALDNVYNADLSANLTDHFDAIFCAKYK 196
            |......|.::.:..::|..:|  ...||.:.:|.::..||.|........:.|..||
 Frog   176 CVNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNLVCDTYK 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 41/105 (39%)
ifi30NP_001017196.1 GILT 60..161 CDD:281251 41/104 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.880

Return to query results.
Submit another query.