DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and GILT3

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_651165.1 Gene:GILT3 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster

Alignment Length:205 Identity:79/206 (38%)
Similarity:113/206 (55%) Gaps:8/206 (4%)


  Fly     7 VCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPY 71
            :||||.|   .||...:.|...||.:.::||||||..|.|:..:|..::...|....|||.|.|:
  Fly    11 LCLLLVW---PTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPF 72

  Fly    72 G-----NARTNDDGNVECQHGVMECELNAWHACILEHHDIAQSLKLIACMMRGKKNRLEKCADHY 131
            |     |..:..:..|.|||||.||||||.||||:|..||.::..||.||:|...|.|..|:...
  Fly    73 GKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETLDIRKAFNLIYCMLRSYSNELGPCSRSM 137

  Fly   132 QIDVGDVKNCKKTRQVNDILRKYGKETAKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYK 196
            .:||...:.||.:|...:||..|||||.|:....||.:..:|.::.....::.::|:..||.:|.
  Fly   138 GVDVSKARECKASRTTAEILAPYGKETLKLGISFVPTIVFENDFDPYDQRSIRNNFERHFCRQYL 202

  Fly   197 EKFNKQLNNC 206
            :|||.:|..|
  Fly   203 KKFNIKLPTC 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 44/103 (43%)
GILT3NP_651165.1 GILT 33..127 CDD:308710 41/94 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140903046
eggNOG 1 0.900 E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2197
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 P PTHR13234
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.