DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and GILT3

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster


Alignment Length:205 Identity:79/205 - (38%)
Similarity:113/205 - (55%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPY 71
            :||||.|   .||...:.|...||.:.::||||||..|.|:..:|..::...|....|||.|.|:
  Fly    11 LCLLLVW---PTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPF 72

  Fly    72 G-----NARTNDDGNVECQHGVMECELNAWHACILEHHDIAQSLKLIACMMRGKKNRLEKCADHY 131
            |     |..:..:..|.|||||.||||||.||||:|..||.::..||.||:|...|.|..|:...
  Fly    73 GKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETLDIRKAFNLIYCMLRSYSNELGPCSRSM 137

  Fly   132 QIDVGDVKNCKKTRQVNDILRKYGKETAKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYK 196
            .:||...:.||.:|...:||..|||||.|:....||.:..:|.::.....::.::|:..||.:|.
  Fly   138 GVDVSKARECKASRTTAEILAPYGKETLKLGISFVPTIVFENDFDPYDQRSIRNNFERHFCRQYL 202

  Fly   197 EKFNKQLNNC 206
            :|||.:|..|
  Fly   203 KKFNIKLPTC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 44/102 (43%)
GILT3NP_651165.1 GILT 33..127 CDD:308710 41/93 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464100
Domainoid 1 1.000 78 1.000 Domainoid score I15625
eggNOG 1 0.900 - - E1_KOG3160
Homologene 1 1.000 - - H120117
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D110446at33392
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 1 0.900 - - OOG6_132507
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
1312.810

Return to query results.
Submit another query.