DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and GILT1

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_650287.3 Gene:GILT1 FlyBaseID:FBgn0038149 Length:250 Species:Drosophila melanogaster

Alignment Length:221 Identity:57/222 (26%)
Similarity:101/222 (45%) Gaps:53/222 (24%)


  Fly     7 VCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPY 71
            ||||:..: :||     ...|.::.|::|||:|||...:|:|.|:.|: |:.:.....:||.||:
  Fly     8 VCLLMSCL-IAT-----AYSAAKVPISIYYESLCPDSAKFITEQVYPA-VKGELRDVVELTFVPF 65

  Fly    72 GNARTNDDGN---VECQHGVMECELNAWHACILEHHDI----------AQSLKLIACMMRGKKN- 122
            |.::....|:   ..|.||..||..|..|||.:||...          :.::..|.|:|:..|| 
  Fly    66 GKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNF 130

  Fly   123 -----RLEKCADHYQIDVGD-VKNCKKTRQVNDILRKYGKETAKVS--FQGVPAVALDNVYNADL 179
                 ..::||....|:..: :|.|..:.:.:.:|||.|:.|.::.  ...||.:.         
  Fly   131 PDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTIL--------- 186

  Fly   180 SANLTDHFDAIFCAKYKEKFNKQLNN 205
                           :.|:|:|::|:
  Fly   187 ---------------FNEQFDKKVND 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 36/117 (31%)
GILT1NP_650287.3 GILT 26..143 CDD:308710 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 P PTHR13234
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
54.940

Return to query results.
Submit another query.