DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and CG9427

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_649919.1 Gene:CG9427 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster

Alignment Length:209 Identity:60/210 (29%)
Similarity:102/210 (49%) Gaps:32/210 (15%)


  Fly     5 VFVCLLLGWVGV-ATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTL 68
            :.:.|.|||..: ..||..|  |:::|.|||.||:|||....|: .||.|  |.::...:.|:.|
  Fly    11 LLLVLSLGWAKLEEKPREKR--QSNKLHITLLYESLCPDSRNFM-HQLGP--VYEEFGDYIDILL 70

  Fly    69 VPYGNARTNDDGNV-ECQHGVMECELNAWHACILEH-HDIAQSLKLIAC-MMRGKKNRLEKCADH 130
            ||:|.:::..:|.: .||||..||:.|...:|::.. .:.|..:|.:.| |:....:|:::||:.
  Fly    71 VPFGKSQSERNGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANE 135

  Fly   131 YQIDVGDVKNC-------KKTRQVNDILRKYGKETAKVSFQGVPAVALDNVYNADLSANLTDH-- 186
            ..: :.||.:|       |...|...:.::|..     ||  :|.:    |||......|.||  
  Fly   136 AGL-LTDVVHCLSSETGTKLQLQAELVTKQYSP-----SF--IPTI----VYNGVFDQQLQDHSL 188

  Fly   187 --FDAIFCAKYKEK 198
              |....|...:::
  Fly   189 RDFRGTVCYMLRQQ 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 34/101 (34%)
CG9427NP_649919.1 GILT 36..136 CDD:281251 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 P PTHR13234
RoundUp 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.