DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and F37H8.5

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_496397.1 Gene:F37H8.5 WormBaseID:WBGene00009514 Length:277 Species:Caenorhabditis elegans

Alignment Length:202 Identity:56/203 (28%)
Similarity:95/203 (47%) Gaps:39/203 (19%)


  Fly    29 RLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNARTNDDGNVECQHGVMECEL 93
            ::.||:..|||||.|..|:|.||.| :|.::...:.::.|||:|||:..:||.::||||..||.:
 Worm    75 KINITVLIEALCPDCQNFLTKQLYP-IVFKNFANYVNIELVPFGNAKVLEDGTIKCQHGEEECSI 138

  Fly    94 NAWHACILEHHDIAQSLKLIACMMRGKKNRLE------KCADHYQIDVGDV----KNCKKTRQVN 148
            |.:..|.::.......|..::|:....:.::|      :|.:..||. ||:    ::|..::...
 Worm   139 NKFEGCFIDSMQDQSPLPTLSCIEESLQKKVEFADAVQQCFEKLQIG-GDIQRLTQSCLVSKLGA 202

  Fly   149 DILRKYGKETAKV-------------------SFQG----VPAVALDNVYNADLSANLTDHFDAI 190
            |:..|....||.|                   ||||    :|.: |...|:.|   ....:.:|.
 Worm   203 DLQNKAAAATANVWPEQHKFVPWVIINGVSLTSFQGFQNQLPTL-LCEWYSGD---KAIPYCEAA 263

  Fly   191 FCAKYKE 197
            ...|||:
 Worm   264 LKLKYKK 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 34/104 (33%)
F37H8.5NP_496397.1 GILT 77..182 CDD:281251 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.677 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.