DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and ifi30

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001006057.1 Gene:ifi30 ZFINID:ZDB-GENE-030131-8447 Length:255 Species:Danio rerio

Alignment Length:197 Identity:59/198 (30%)
Similarity:94/198 (47%) Gaps:22/198 (11%)


  Fly    27 ADRLAITLYYEALCPYCMEFVTTQLNPSMVR-QDRLPFTDLTLVPYGNAR-TNDDGN--VECQHG 87
            ||::.::||||:|||.|..|:|:||.|:::. ||   ..::.|||||||: |...|.  ..||||
Zfish    59 ADKVKVSLYYESLCPGCRMFLTSQLVPTLIMLQD---IMEIDLVPYGNAQETQAQGKYIFTCQHG 120

  Fly    88 VMECELNAWHACILEHHDIAQSLKLIACMMRGKK--NRLEKCADHYQIDV--GDVKNCKKTRQVN 148
            ..||..|....|:|....: .::.:|.||..|..  ...:.|...|:.||  ..:..|.|..|.|
Zfish   121 EDECLGNMIETCMLNKLGL-DAVMVIFCMESGNDVLKSAQPCLGVYRPDVTWDSIMQCVKGDQGN 184

  Fly   149 DILRKYGKETAKVS--FQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKEK--------FNKQL 203
            .::.:...:|..::  .|.||.:.::..:..||.........::.|:.||.:        ..|..
Zfish   185 KLMHENAVKTDALNPPHQYVPWITVNGEHTDDLQDKAMGSLFSLVCSLYKGQKPAACTLGLKKNT 249

  Fly   204 NN 205
            ||
Zfish   250 NN 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 38/104 (37%)
ifi30NP_001006057.1 SapA <31..52 CDD:321954
GILT 63..162 CDD:308710 38/103 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110992065
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.917 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.