DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and Ifi30

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001025197.1 Gene:Ifi30 RGDID:1310758 Length:248 Species:Rattus norvegicus

Alignment Length:163 Identity:51/164 (31%)
Similarity:79/164 (48%) Gaps:25/164 (15%)


  Fly    15 GVAT----------PRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPS--MVRQDRLPFTDLT 67
            |.||          ||||.  .|..:.::||||:||..|..|:...|.|:  ||    :...::|
  Rat    36 GAATCKAHDLCLFGPRRLL--SAPPVNVSLYYESLCGACRYFLVRNLFPTWLMV----MEIMNIT 94

  Fly    68 LVPYGNAR-TNDDGNVE--CQHGVMECELNAWHACILEHHDIAQSLKLIACM--MRGKKNRLEKC 127
            |||||||: .|..|..|  ||||.:||:||...||:|:..:...:...|.||  |...:.:|..|
  Rat    95 LVPYGNAQERNVSGTWEFTCQHGELECKLNKVEACLLDKLEKEAAFLTIVCMEEMEDMEKKLGPC 159

  Fly   128 ADHY--QIDVGDVKNCKKTRQVNDILRKYGKET 158
            ...|  ::....:..|...::..:::.:..:.|
  Rat   160 LQLYVPEVSPESIMECATGKRGTELMHENAQLT 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 40/105 (38%)
Ifi30NP_001025197.1 GILT 60..163 CDD:281251 40/107 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.920 Consistency score
TreeFam 1 0.960
76.780

Return to query results.
Submit another query.