DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and ZK669.3

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_495669.1 Gene:ZK669.3 WormBaseID:WBGene00014053 Length:218 Species:Caenorhabditis elegans

Alignment Length:155 Identity:38/156 (24%)
Similarity:72/156 (46%) Gaps:19/156 (12%)


  Fly     5 VFVCLLLGWVGVATPRRLRGPQADRLAITLYYEALC---PYCMEFVTTQLNPSMVRQDRLPFTDL 66
            ||:||:| ::...:..:.:|...|.:.|..:.|..|   .|.|::....:...:....|:.|   
 Worm     7 VFICLIL-FITKISYAKDKGANGDMVNIVAFGEGRCSDTSYWMKWHWLPMWRMLGSTGRINF--- 67

  Fly    67 TLVPYG------NARTNDDGNVECQHGVMECELNAWHACILEH-HDIAQSLKLIACMMRGKKN-- 122
            ...|||      ::.:.||...:|.||..||.||...||::|. .:....::::.| ::||:|  
 Worm    68 DYHPYGIKTTCVDSESADDVVCDCHHGNRECLLNQLQACVIEALPNFEDYMEVVTC-IQGKQNIS 131

  Fly   123 -RLEKCAD-HYQIDVGDVKNCKKTR 145
             ..|.|.: ..::|...:..|.::|
 Worm   132 MAAEVCFEGPTKLDRTKMMECAESR 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 28/112 (25%)
ZK669.3NP_495669.1 GILT 32..139 CDD:281251 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110992571
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.