DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and ZK669.3

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_495669.1 Gene:ZK669.3 / 191388 WormBaseID:WBGene00014053 Length:218 Species:Caenorhabditis elegans


Alignment Length:155 Identity:38/155 - (24%)
Similarity:72/155 - (46%) Gaps:19/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFVCLLLGWVGVATPRRLRGPQADRLAITLYYEALC---PYCMEFVTTQLNPSMVRQDRLPFTDL 66
            ||:||:| ::...:..:.:|...|.:.|..:.|..|   .|.|::....:...:....|:.|   
 Worm     7 VFICLIL-FITKISYAKDKGANGDMVNIVAFGEGRCSDTSYWMKWHWLPMWRMLGSTGRINF--- 67

  Fly    67 TLVPYG------NARTNDDGNVECQHGVMECELNAWHACILEH-HDIAQSLKLIACMMRGKKN-- 122
            ...|||      ::.:.||...:|.||..||.||...||::|. .:....::::.| ::||:|  
 Worm    68 DYHPYGIKTTCVDSESADDVVCDCHHGNRECLLNQLQACVIEALPNFEDYMEVVTC-IQGKQNIS 131

  Fly   123 -RLEKCAD-HYQIDVGDVKNCKKTR 145
             ..|.|.: ..::|...:..|.::|
 Worm   132 MAAEVCFEGPTKLDRTKMMECAESR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 28/111 (25%)
ZK669.3NP_495669.1 GILT 32..139 CDD:281251 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.