DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and ZK669.2

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_495668.1 Gene:ZK669.2 WormBaseID:WBGene00014052 Length:264 Species:Caenorhabditis elegans

Alignment Length:193 Identity:44/194 (23%)
Similarity:81/194 (42%) Gaps:26/194 (13%)


  Fly    20 RRLRGPQADR-----LAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNA---RT 76
            :.:...||.|     :.|..:.|:|||....:....:.|...........::|..|:|.|   |:
 Worm    59 KAMMADQASRAKTPPINIEFFGESLCPDTTRYFRNHIMPVWTSLQASSTINITYHPFGLASCRRS 123

  Fly    77 NDDG-NVECQHGVMECELNAWHACILEHHDIAQ-SLKLIACMMRGK---KNRLEKCADHYQ---- 132
            .:.| ...||||..||:||...||::....:.| .|.::.| |:||   .:.::.|..:::    
 Worm   124 AETGIRCNCQHGPAECQLNMLQACVISTLQVPQLYLPIVNC-MQGKNKFSSAVDDCIVNFRPRPD 187

  Fly   133 IDVGDVKNCKKTRQVNDILRKYG---KETAKVSFQGVPAVALDNVYNADLSANLTDHFDAIFC 192
            :|...:..|.:::....::.::|   ||.|. ....||.:.:    |...|....:....|.|
 Worm   188 LDENFMARCAQSQLGAKLMMQHGYRQKEVAS-ELDWVPWILI----NGRRSQAAENQLKTIVC 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 29/106 (27%)
ZK669.2NP_495668.1 GILT 75..178 CDD:281251 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110992567
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
TreeFam 1 0.960
98.740

Return to query results.
Submit another query.