DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and Y18D10A.2

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_493240.2 Gene:Y18D10A.2 WormBaseID:WBGene00012475 Length:212 Species:Caenorhabditis elegans

Alignment Length:173 Identity:43/174 (25%)
Similarity:66/174 (38%) Gaps:21/174 (12%)


  Fly    40 CPYCMEFVTTQLNPSMVR-----QDRLPFTDLTLVPYGNARTNDDGNVECQHGVMECELNAWHAC 99
            ||...:|:..||.|....     .|.|.. |...||.|..:.:......|.||.:||.||....|
 Worm    47 CPDTSKFIHNQLVPFYQNYKGNLSDGLKL-DFHAVPTGGHQVDGKYVNRCLHGALECALNKLQMC 110

  Fly   100 ILEHHDIAQSLKLIACMMRGKK--NRLEKCADHYQIDVGD-VKNCKKTRQVNDIL---RKYGKET 158
            ..:|  |.|...:.|..::||.  :...||..  ..:.|. |:||.::.:...:|   ..|....
 Worm   111 SKKH--IKQDWLVTAGCIQGKTAYSAGLKCLP--DTEEGKIVQNCAESEEGEYLLNDENSYRYNV 171

  Fly   159 AKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKEKFNK 201
            |..| ..:|.:.::...|.:....|.|    :.|.....|.|:
 Worm   172 APHS-AWLPWIQVNGERNRNAEFKLKD----VICQLESMKGNE 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 28/97 (29%)
Y18D10A.2NP_493240.2 GILT 39..142 CDD:281251 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110990951
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.