DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and W04A4.3

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_493398.1 Gene:W04A4.3 WormBaseID:WBGene00012232 Length:149 Species:Caenorhabditis elegans

Alignment Length:135 Identity:26/136 (19%)
Similarity:62/136 (46%) Gaps:22/136 (16%)


  Fly     2 RAAVFVCLLLGW-----VGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSM------ 55
            :.::||.:::.:     :.:.||  ::....|.:.||.:  |.|....::..|||.|.:      
 Worm     5 KQSIFVTMVMIYSVILIITIFTP--VQQIHVDIIDITGF--AKCALTTKWFRTQLAPFLGNLTAK 65

  Fly    56 --VRQDRLPFTDLTLVPYGNARTNDDGNVECQHGVMECELNAWHACILEHHDIAQSLKLIACM-- 116
              .:..::.:..|::   |..:.|......|::|.:||:||....|..::.......:::|.:  
 Worm    66 KGPKNLKMVYHPLSI---GQKKGNGTAVATCENGWLECQLNKLQCCTKKYSRNVTDFEILAVLEC 127

  Fly   117 MRGKK 121
            ::||:
 Worm   128 IQGKQ 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 21/101 (21%)
W04A4.3NP_493398.1 GILT 36..142 CDD:281251 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110990966
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13234
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.