powered by:
                   
 
    
    
             
          
            Protein Alignment GILT2 and W04A4.3
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_651166.1 | Gene: | GILT2 / 42788 | FlyBaseID: | FBgn0039099 | Length: | 207 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_493398.1 | Gene: | W04A4.3 / 189179 | WormBaseID: | WBGene00012232 | Length: | 149 | Species: | Caenorhabditis elegans | 
        
        
        
          
            | Alignment Length: | 135 | Identity: | 26/135 - (19%) | 
          
            | Similarity: | 62/135 -  (45%) | Gaps: | 22/135 - (16%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     2 RAAVFVCLLLGW-----VGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSM------ 55:.::||.:::.:     :.:.||  ::....|.:.||.:  |.|....::..|||.|.:
 Worm     5 KQSIFVTMVMIYSVILIITIFTP--VQQIHVDIIDITGF--AKCALTTKWFRTQLAPFLGNLTAK 65
 
 
  Fly    56 --VRQDRLPFTDLTLVPYGNARTNDDGNVECQHGVMECELNAWHACILEHHDIAQSLKLIACM-- 116.:..::.:..|::   |..:.|......|::|.:||:||....|..::.......:::|.:
 Worm    66 KGPKNLKMVYHPLSI---GQKKGNGTAVATCENGWLECQLNKLQCCTKKYSRNVTDFEILAVLEC 127
 
 
  Fly   117 MRGKK 121::||:
 Worm   128 IQGKQ 132
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | GILT2 | NP_651166.1 | GILT | 32..130 | CDD:308710 | 21/100 (21%) | 
          
            | W04A4.3 | NP_493398.1 | GILT | 36..142 | CDD:281251 | 21/102 (21%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C160164067 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_KOG3160 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 2.740 |  | 
        
      
           
             Return to query results.
             Submit another query.