DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and C02D5.2

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001040839.1 Gene:C02D5.2 / 176203 WormBaseID:WBGene00015336 Length:323 Species:Caenorhabditis elegans


Alignment Length:174 Identity:45/174 - (25%)
Similarity:85/174 - (48%) Gaps:10/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNARTNDDGN---VE 83
            ::.|..:.:.:.:|.||.||....|...||..:.....||...:|.::|:|.||..:.||   .:
 Worm   131 IKEPVENIVKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQ 195

  Fly    84 CQHGVMECELNAWHACILEHHDIA-QSLKLIACMMRGKKNRLE--KC-ADHYQIDVGDVKNCKKT 144
            ||||..||::|....|:::..... :.|..:.| |:||.:..|  || .::|..:...::.|...
 Worm   196 CQHGPTECQINQLMNCVIDRFGFPHRYLPGVLC-MQGKYSLDEAMKCVTENYPSEYERMRECASG 259

  Fly   145 RQVNDILRKYGKETAKV--SFQGVPAVALDNVYNADLSANLTDH 186
            .:...:|...|::||.:  :...:|.:.::...|:|...:||.:
 Worm   260 TRGRRLLALSGQKTASLTPAIDFIPWIVINGSRNSDALYDLTQN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 33/104 (32%)
C02D5.2NP_001040839.1 GILT 140..246 CDD:281251 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.