DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and C02D5.2

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001040839.1 Gene:C02D5.2 WormBaseID:WBGene00015336 Length:323 Species:Caenorhabditis elegans

Alignment Length:174 Identity:45/175 (26%)
Similarity:85/175 (49%) Gaps:10/175 (6%)


  Fly    22 LRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNARTNDDGN---VE 83
            ::.|..:.:.:.:|.||.||....|...||..:.....||...:|.::|:|.||..:.||   .:
 Worm   131 IKEPVENIVKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQ 195

  Fly    84 CQHGVMECELNAWHACILEHHDIA-QSLKLIACMMRGKKNRLE--KC-ADHYQIDVGDVKNCKKT 144
            ||||..||::|....|:::..... :.|..:.| |:||.:..|  || .::|..:...::.|...
 Worm   196 CQHGPTECQINQLMNCVIDRFGFPHRYLPGVLC-MQGKYSLDEAMKCVTENYPSEYERMRECASG 259

  Fly   145 RQVNDILRKYGKETAKV--SFQGVPAVALDNVYNADLSANLTDH 186
            .:...:|...|::||.:  :...:|.:.::...|:|...:||.:
 Worm   260 TRGRRLLALSGQKTASLTPAIDFIPWIVINGSRNSDALYDLTQN 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 33/105 (31%)
C02D5.2NP_001040839.1 GILT 140..246 CDD:281251 33/107 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
TreeFam 1 0.960
65.910

Return to query results.
Submit another query.