DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and R07E5.4

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_497886.2 Gene:R07E5.4 WormBaseID:WBGene00011112 Length:186 Species:Caenorhabditis elegans

Alignment Length:184 Identity:42/185 (23%)
Similarity:76/185 (41%) Gaps:33/185 (18%)


  Fly    26 QADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNARTNDDGN----VECQH 86
            ||.::.:|::.|:.||||.:.:..|:.|..|  :|....:|.:||:|......|.|    ..|.|
 Worm    15 QAQQVNVTIFTESQCPYCTKLLREQIWPFYV--NRPGIMNLQIVPFGKGDCTYDYNRNFHCTCMH 77

  Fly    87 GVMECELNAWHACILEHHDIAQSLKLIACM--MRGKKNRLEKCADHYQIDVGDVKNCKK------ 143
            |..||:||....|.:.:.. .:.|.|:.|:  :...:....||.....      .|.::      
 Worm    78 GATECDLNRLQNCAISYFP-RRHLGLVTCLQGLTTLREGFSKCLSRLS------PNTQRKLIECA 135

  Fly   144 TRQVNDILRKYGK-ETAKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYK 196
            |.|..::|..|.. .|.:...:..|.:.::.|:           ||..:..::|
 Worm   136 TTQTGELLNYYSMVNTHRAGVRIWPTMYVNGVF-----------FDRSYPVEHK 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 29/104 (28%)
R07E5.4NP_497886.2 GILT 20..123 CDD:281251 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.650 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.