DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and pqn-48

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_494711.1 Gene:pqn-48 WormBaseID:WBGene00004135 Length:319 Species:Caenorhabditis elegans

Alignment Length:127 Identity:42/128 (33%)
Similarity:65/128 (51%) Gaps:11/128 (9%)


  Fly    20 RRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNARTNDDGNVEC 84
            |..|.|    :.|||.||||||||.:|:..||. |:..|.:.... |.|||:||:|...||:..|
 Worm   135 RHRRQP----IKITLIYEALCPYCQKFIANQLG-SVFNQFQGQLI-LELVPWGNSRIMRDGSFSC 193

  Fly    85 QHGVMECELNAWHACILEHHDIAQSLKLIACMMR-----GKKNRLEKCADHYQIDVGDVKNC 141
            .||..||:.|...:|:::...:..:|..|.|..|     |.::.::.|:...:.....::.|
 Worm   194 NHGQKECDANRLQSCVIDILKVKGALPFIVCFERNIQHYGVEHAMQTCSAFIRSQYRQIRQC 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 38/103 (37%)
pqn-48NP_494711.1 GILT 142..242 CDD:281251 38/102 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.629 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.780

Return to query results.
Submit another query.