DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GILT2 and IFI30

Sequence 1:NP_651166.1 Gene:GILT2 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_006323.2 Gene:IFI30 HGNCID:5398 Length:250 Species:Homo sapiens

Alignment Length:190 Identity:56/191 (29%)
Similarity:85/191 (45%) Gaps:20/191 (10%)


  Fly    22 LRGP----QADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNAR-TNDDGN 81
            ||||    .|..:.:||||||||..|..|:..:|.|:.:..  :...::||||||||: .|..|.
Human    50 LRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLV--MEILNVTLVPYGNAQEQNVSGR 112

  Fly    82 VE--CQHGVMECELNAWHACILEHHDIAQSLKLIACM--MRGKKNRLEKCADHYQ--IDVGDVKN 140
            .|  ||||..||:.|...||:|:..|:..:...|.||  ....:..|..|...|.  :....:..
Human   113 WEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIME 177

  Fly   141 CKKTRQVNDILRKYGKETAKVS--FQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKEK 198
            |....:...::....:.|..:.  .:.||.|.::.....|.:..||     :.|..|:.|
Human   178 CAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLT-----LVCQLYQGK 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 39/103 (38%)
IFI30NP_006323.2 GILT 63..164 CDD:308710 39/103 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3160
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128734
Panther 1 1.100 O PTHR13234
Phylome 1 0.910 0.913 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2953
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.