DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-IIb

DIOPT Version :9

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster


Alignment Length:168 Identity:55/168 - (32%)
Similarity:91/168 - (54%) Gaps:11/168 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 LYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEVSAEA 275
            ||:||:|:...|||||.|...||...::..|:||.|..|:|:.||:|.::...:|.:.|||:|:|
  Fly   127 LYSIKFYRGQMEFYRYTPGEYPPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADA 191

  Fly   276 PNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPIL--- 337
            |.:|:.....:|.:|..|...|.:..:..:|:.|:.|..||::..|.|.:.|::.:|..|:.   
  Fly   192 PLYSTATAFAQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVSIPF 256

  Fly   338 --DEHYLHKYNDIVHKHGLITSTLGLQLPLEPRHFHEG 373
              :..|:...:      .||.|.|.|:|.|:..||..|
  Fly   257 TEETQYIRTVD------SLIASRLSLKLQLQATHFVAG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 29/72 (40%)
Ig 314..>362 CDD:299845 12/52 (23%)
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.