DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: beat-IV and beat-IIb

Sequence 1:NP_001262876.1 Gene:beat-IV FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_650613.2 Gene:beat-IIb FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster

Alignment Length:168 Identity:55/169 (33%)
Similarity:91/169 (54%) Gaps:11/169 (7%)


  Fly   211 LYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEVSAEA 275
            ||:||:|:...|||||.|...||...::..|:||.|..|:|:.||:|.::...:|.:.|||:|:|
  Fly   127 LYSIKFYRGQMEFYRYTPGEYPPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADA 191

  Fly   276 PNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPIL--- 337
            |.:|:.....:|.:|..|...|.:..:..:|:.|:.|..||::..|.|.:.|::.:|..|:.   
  Fly   192 PLYSTATAFAQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVSIPF 256

  Fly   338 --DEHYLHKYNDIVHKHGLITSTLGLQLPLEPRHFHEG 373
              :..|:...:      .||.|.|.|:|.|:..||..|
  Fly   257 TEETQYIRTVD------SLIASRLSLKLQLQATHFVAG 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 29/73 (40%)
Ig 314..>362 CDD:299845 13/53 (25%)
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 30/71 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.