powered by:
                   
 
    
    
             
          
            Protein Alignment beat-IV and beat-IIb
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001262876.1 | Gene: | beat-IV / 42778 | FlyBaseID: | FBgn0039089 | Length: | 446 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_650613.2 | Gene: | beat-IIb / 42082 | FlyBaseID: | FBgn0038494 | Length: | 407 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 168 | Identity: | 55/168 - (32%) | 
          
            | Similarity: | 91/168 -  (54%) | Gaps: | 11/168 - (6%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly   211 LYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEVSAEA 275||:||:|:...|||||.|...||...::..|:||.|..|:|:.||:|.::...:|.:.|||:|:|
 Fly   127 LYSIKFYRGQMEFYRYTPGEYPPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADA 191
 
 
  Fly   276 PNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPIL--- 337|.:|:.....:|.:|..|...|.:..:..:|:.|:.|..||::..|.|.:.|::.:|..|:.
 Fly   192 PLYSTATAFAQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVSIPF 256
 
 
  Fly   338 --DEHYLHKYNDIVHKHGLITSTLGLQLPLEPRHFHEG 373:..|:...:      .||.|.|.|:|.|:..||..|
 Fly   257 TEETQYIRTVD------SLIASRLSLKLQLQATHFVAG 288
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0000798 | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR21261 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 3.010 |  | 
        
      
           
             Return to query results.
             Submit another query.