DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-Vc

DIOPT Version :8

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001356887.1 Gene:beat-Vc / 41575 FlyBaseID:FBgn0038084 Length:297 Species:Drosophila melanogaster

Alignment Length:248 Identity:74/249 (30%)
Similarity:109/249 (44%) Gaps:56/249 (22%)


  Fly   211 LYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDAS--------RVLLRGLTLNSTGLY 267
            |.::|||||..||:||.|...|....:.|.||.:    :|.|        .|.|..||.:|:|.|
  Fly    56 LNSVKWYKDGLEFFRYSPLTPPTTNWFPVKGVTI----ADGSPHCNQFICNVELEKLTAHSSGQY 116

  Fly   268 RCEVSAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVN 332
            |||||.:||.|..:.....|.:..||:..|.|.|.::.|:..:||..||::..|.|.:.|.|::|
  Fly   117 RCEVSGDAPEFKLIDQTANMTVGVLPKFDPFISGVRHAYKYHDYLEANCSTEMSSPMAKLTWYIN 181

  Fly   333 E--------QPILDEHYLHKYNDIVHKHGLITSTLGLQLPLEPRHF-HEGDM-RVKCLASISPVL 387
            .        ||.::|  :.:..|..|   |..|.|.|:|.|:.:.| .:.:| .::|.|.|    
  Fly   182 NKTAPGHSLQPQINE--VSRNVDGFH---LFASHLHLRLHLDDQRFISKSEMLELRCTADI---- 237

  Fly   388 WKGGKESVLQRRPGIIDNREAMLLVKGAAGHSESSFLRTLTIAIILARTGQWL 440
                                     .|.|.....|.:||..:|:..|.|.|.|
  Fly   238 -------------------------MGLAAVRRESRVRTTILALRDAGTKQRL 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 31/81 (38%)
Ig 314..>362 CDD:299845 16/56 (29%)
beat-VcNP_001356887.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.