DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: beat-IV and beat-IIIc

Sequence 1:NP_001262876.1 Gene:beat-IV FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_724042.1 Gene:beat-IIIc FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster

Alignment Length:234 Identity:102/235 (43%)
Similarity:149/235 (63%) Gaps:8/235 (3%)


  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRV-IEELSDASRVLLRGLTLNSTGLYRCE 270
            :|||||::|||||..|||||||:..||..::.:.||.| :...|||. |.||.:.|.|.|.:|||
  Fly    51 DGEALYSVKWYKDGNEFYRYVPRDMPPAQTFLLPGVNVDLHNSSDAI-VTLRNVNLQSAGRFRCE 114

  Fly   271 VSAEAPNFSSVQGEGRMDIVFLPRDG-PHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQ 334
            ||.|||:|.:|...|.|.:.:||.:| |.|.|.:.:||||:|:.:|||:|:|.||..|.|.||.:
  Fly   115 VSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGE 179

  Fly   335 PILDEHYLHKYNDIVH-KHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKESVLQR 398
            |: ::..|.||:.||. :.||.||.||||..:|.:||.:|:|::||:|.:|.|.|:..:|||...
  Fly   180 PV-EQQKLRKYDTIVSGRDGLETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGD 243

  Fly   399 RP---GIIDNREAMLLVKGAAGHSESSFLRTLTIAIILA 434
            ||   .::::||.:......|...:.:..|.|.:..||:
  Fly   244 RPQKAPVLESRETVYASNSRADPVQGTSYRELFVTKILS 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 37/74 (50%)
Ig 314..>362 CDD:299845 24/49 (49%)
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 41/77 (53%)
Ig 42..127 CDD:143165 41/77 (53%)
Ig 140..219 CDD:299845 38/80 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.