DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-IIIa

DIOPT Version :8

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster

Alignment Length:241 Identity:95/242 (39%)
Similarity:142/242 (59%) Gaps:9/242 (4%)


  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEV 271
            :||:||::|||||..|.|||||:.:||..|:.:.||.:....|..:::|||.:||.|:|||||||
  Fly    98 DGESLYSVKWYKDGHEIYRYVPRDKPPGQSFPLPGVNIDLRNSSDTQILLRRVTLQSSGLYRCEV 162

  Fly   272 SAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPI 336
            |.|||.|::|.....|.:|..|..||.|.|.|.:||||:.:.:||||..|.|..||.|.:|.:|:
  Fly   163 SGEAPAFNTVSESETMTVVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKPVCHLSWLINGEPV 227

  Fly   337 LDEHYLHKYND-IVHKHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKESV---LQ 397
            ...| |.:|:. :|::.||..:.|||:..:...||..|||::||:|.||.:..:..:|||   .|
  Fly   228 QKTH-LRQYDKVVVNRDGLEMARLGLEFRVRSFHFKHGDMKLKCVAKISSLYLQSNEESVESDRQ 291

  Fly   398 RRPGIIDNREAML----LVKGAAGHSESSFLRTLTIAIILARTGQW 439
            .|...:::||.:.    .:..|.....||.:.:|...::|.....|
  Fly   292 HRAPALESRETVAAKSSTIAAACSKLPSSLIVSLPPVLLLLLFQNW 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 37/73 (51%)
Ig 314..>362 CDD:299845 20/49 (41%)
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 42/85 (49%)
IG_like 88..182 CDD:214653 42/84 (50%)
Ig 188..>227 CDD:299845 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.