DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-Ic

DIOPT Version :8

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster

Alignment Length:278 Identity:84/279 (30%)
Similarity:129/279 (46%) Gaps:44/279 (16%)


  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPP-KTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCE 270
            |.:.||::||||...|||||.||..|. |......|:.|...||:.|.|:|:.:.||.:|.:.||
  Fly    83 ENDTLYSVKWYKGKREFYRYTPKENPAMKVFAMTSGLNVERNLSNQSHVVLQSVPLNISGKFTCE 147

  Fly   271 VSAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQP 335
            :|.|||.|.:....|.|::|.||.:...:.|.|.:|:||:.:..||:...|.||::|.|.:| ..
  Fly   148 ISVEAPTFQTAMVSGEMEVVELPEEHTVVTGIQARYRIGDLVDGNCSIKYSKPAANLTWTIN-GI 211

  Fly   336 ILDEHYLHKYNDIVHKHGLITS-TLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKESVLQ-- 397
            ::..|::..|.....::..:.| |..:...:..:||.:|.||:||.|:|..: :|...|||::  
  Fly   212 VVPPHHIKTYQTEKRENSTLESVTSAIHFMVTNQHFLKGQMRLKCTANIFDI-FKEEMESVIEED 275

  Fly   398 ------------------------RRPGIIDNREAML-------LVKGAAGHSESSF-------L 424
                                    .|.|..|:.|:.|       ...||:..:...|       |
  Fly   276 RPRIMASGRSYDINNYPLEEHTNGERGGFEDHNESYLTYYSADNTASGASTAAHEIFWQFWPSQL 340

  Fly   425 RTLTIAIILARTGQWLLG 442
            ..|.|...||....||.|
  Fly   341 TKLPINRQLAGAWHWLCG 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 31/74 (42%)
Ig 314..>362 CDD:299845 12/49 (24%)
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.