DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4393 and ANKS1B

Sequence 1:NP_001287483.1 Gene:CG4393 FlyBaseID:FBgn0039075 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001339115.1 Gene:ANKS1B HGNCID:24600 Length:1285 Species:Homo sapiens

Alignment Length:1479 Identity:427/1480 (29%)
Similarity:624/1480 (42%) Gaps:421/1480 (28%)


  Fly     1 MGKDQEFLEAARNGNISHIEKVLTQK-----AKRAGP-----LASLRRGTGVNVQDSGGYSALHH 55
            ||||||.|||||.||::.:||:|:.:     ...:||     |.|:.||..||..||.||:||||
Human     1 MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGYTALHH 65

  Fly    56 ACLNGHEDIVRLLLAHEASPNLPDSRGSSPLHLAAWAGETEIVRLLLTHPYRPASANLQTIEQET 120
            |.||||:|||..||.:|||.|:.|::|..|:|||||.|:.|||::|:.|....:..|.|..|.||
Human    66 AALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSRVNEQNNENET 130

  Fly   121 PLHCAAQHGHTGALALLLHHDADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAHLGTEA 185
            .||||||:||:..:|:||....||.:|||:.||||||||.||||:.|:|:|.|||.|:: ..|. 
Human   131 ALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMIISAHPNLMS-CNTR- 193

  Fly   186 LERGTPSPSSPASPSRAIFPHTCLHLASRNGHKSVVEVLLSAGVSVNLLTPSGTALHEAALCGKE 250
                               .||.||||:|||||:||:|||.||:.|:..|..|:|||||||.||.
Human   194 -------------------KHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKV 239

  Fly   251 NVVRTLLKAGINLNATDNEGRTALDILREFPPHVTKHIVAVINNF------RNQMDTDEGDEVIY 309
            :|||.||:.||:.|..|:.|||.||||:|.|...:..|..::..:      ...::....::...
Human   240 DVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYLEGVGRSTVLEEPVQEDATQ 304

  Fly   310 RQHSGPPNSGRGQNKHHSQQQPPLSNHYHFNSNNHLLNHSHSMQQSGYSKQRLSAGNGGPYNGGK 374
            ..|...|.....|..........||.         ||:.....|:..||.:              
Human   305 ETHISSPVESPSQKTKSETVTGELSK---------LLDEIKLCQEKDYSFE-------------- 346

  Fly   375 SLDSALQPEDRFYQDLNAHSPLHSQNEMG--GGYSVSPSSSLSSFEPASV----SPRSRCSTGGL 433
              |......|.:..:|:.    .|:.|:|  |..||..||:: :..|..|    ...:.|...||
Human   347 --DLCHTISDHYLDNLSK----ISEEELGKNGSQSVRTSSTI-NLSPGEVEEEDDDENTCGPSGL 404

  Fly   434 GQPMHMSTFAPAGPPKKPPRRNLSVSPTHAGPGQQFSYSSPSSQSQSQSHGHGQNQVRRQPASES 498
            .:.:     .|..     ..|||...                                       
Human   405 WEAL-----TPCN-----GCRNLGFP--------------------------------------- 420

  Fly   499 PYSHQSHGSVGGMSFDETQLRERQRNDRLYASARQSTRSAIAGGMSLSSSN-----DMLDRQCSS 558
                        |...|:..::|.....:..||...|         ..|.|     |::|     
Human   421 ------------MLAQESYPKKRNYTMEIVPSASLDT---------FPSENENFLCDLMD----- 459

  Fly   559 SELNSETSVPNSSGDSPATNSMKRPIPAPRSSTTKLSKELLKSAESATLKSYNPNRKLKRNRNSS 623
                  |:|..    .|.:..:.| .|:||:.         .::|.|.......|     :||||
Human   460 ------TAVTK----KPCSLEIAR-APSPRTD---------NASEVAVTTPGTSN-----HRNSS 499

  Fly   624 GANGAAKSNGGDENCEAKQQIPSSPTHYKQPPTPDHPPPSSSQAERTIHERIRPLSQEYKRRSAL 688
            ..                             ||||..|||...|.:.|.:.|||  |..:|.|.:
Human   500 TG-----------------------------PTPDCSPPSPDTALKNIVKVIRP--QPKQRTSIV 533

  Fly   689 LQL--------QAAQQLMIETGSSPSKLLPTLSTPGYDYDDTVTVVPRCPAPSSGSLSSSISCSD 745
            ..|        |...::...||.:.....|..|.|                      :||:..::
Human   534 SSLDFHRMNHNQEYFEINTSTGCTSFTASPPASPP----------------------TSSVGTTE 576

  Fly   746 ---HSLSHSTDYVEEFVSDVP-------FAGLLKGASQQLKEQPEVKL----KIQEESKPQQTLP 796
               ...:|:.|...:..:|.|       |||||.|:|... |.||...    |.::..|.|..:.
Human   577 VKNEGTNHTDDLSRQDDNDPPKEYDPGQFAGLLHGSSPAC-ESPENPFHLYGKREQCEKGQDEVS 640

  Fly   797 RVRPPIPTKPAIPEKKFAKP------PTTPTNQSLEANGNSSSDVVIKPPRSPSKSPSKTSNKSP 855
            ....|:|.|.: |.:..::|      |...:........|...:..|...|| ::|.|:..::..
Human   641 LANSPLPFKQS-PIENNSEPLVKKIKPKVVSRTIFHKKSNQLENHTIVGTRS-TRSGSRNGDQWV 703

  Fly   856 VKSPG-----------KSPAKSPGSGH---SAARNSINLLS-PFNAEEARKKISE--IIENFGSG 903
            :.:.|           :|..|:....|   |.:::..:|:: |.|.:.:|...||  ..|:...|
Human   704 MNAGGFVERACTLGRIRSLPKALIDMHLSKSVSKSDSDLIAYPSNEKTSRVNWSESSTAEHSSKG 768

  Fly   904 ILNTSITPTHDIE-------LDFEDMEVPNERREL---ATR-----------LRAAGLLHLERIL 947
              |:..||:...|       :...|:.:.||.:|:   .||           |.:.||...|..|
Human   769 --NSERTPSFTSEWEEIDKIMSSIDVGINNELKEMNGETTRPRCPVQTVGQWLESIGLPQYENHL 831

  Fly   948 FENGYDNYKFV-NNVFEEPD---IPLLHIPERDAPKLLRFVQSLPPAE------FQPQVPVKTQQ 1002
            ..||:||.:|: :||.|:.|   |.:|:...|.  ::|:.:|.||...      :.|        
Human   832 MANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQ--RILQAIQLLPKMRPIGHDGYHP-------- 886

  Fly  1003 ENKQMGVATLQQWLNTIALPEYLEFFNKHLYNTIESVCGVWDVELQTVLEINKLGHRRRILQSLA 1067
                   .::.:||::|.|.:|.:.|..:.|.:::.:..:|:|||..||:||.:|||:|||.||.
Human   887 -------TSVAEWLDSIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLG 944

  Fly  1068 YIRQMRDSDSKSQKTP----LGE---NNETNQL---------TTNGN---------GTAR----- 1102
                .|..|...||.|    |.|   |:...||         ||.|:         |.||     
Human   945 ----DRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNE 1005

  Fly  1103 ---EAPPR-----------------------LPANPVH--HRNSITGYRKSRPAPPPPAPPARKT 1139
               :..||                       .|.:.:|  |.....|                 .
Human  1006 NYFDDIPRSKLERQMAQQSSVCEIWTNQNAGFPFSAIHQVHNTGDWG-----------------E 1053

  Fly  1140 AALQIRAPSELLLGLPANLRTTEWRHSAQTLLNEHINYEVQYLGSTVVKELRGTESTKKSIQKLK 1204
            .::.:|.|:|.....|...    |:|..:.|:.:..:|:..||||.::|||||||||:.:..|::
Human  1054 PSITLRPPNEATASTPVQY----WQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMR 1114

  Fly  1205 TS---ADGEVKSGSPLSLAICHRGVEFKDVNSKRTICEHEIQNINCACQDSEDLRHFAYITKE-- 1264
            .:   :..::|....:.|::.::||:|.|..:|..|.||||:||:||.||.|||..||||||:  
Human  1115 ANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLK 1179

  Fly  1265 QDLHYCHVFLVESTDLASEIILTLGQAFEVAYQLAL--RDG--ITTTPE 1309
            .:.||||||.....:||.||||||||||||||||||  |.|  .:|.||
Human  1180 SNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPE 1228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4393NP_001287483.1 Ank_2 <10..79 CDD:289560 38/79 (48%)
ANK 43..171 CDD:238125 72/128 (56%)
ANK repeat 49..79 CDD:293786 20/30 (67%)
Ank_2 53..148 CDD:289560 50/95 (53%)
ANK repeat 81..115 CDD:293786 15/34 (44%)
ANK 112..257 CDD:238125 75/145 (52%)
ANK repeat 117..148 CDD:293786 17/31 (55%)
Ank_2 122..233 CDD:289560 55/111 (50%)
ANK repeat 181..233 CDD:293786 20/52 (38%)
Ank_5 224..276 CDD:290568 30/52 (58%)
ANK repeat 237..267 CDD:293786 18/30 (60%)
SAM_AIDA1AB-like_repeat2 1005..1069 CDD:188899 23/64 (36%)
SAM 1009..1075 CDD:197735 24/66 (36%)
PTB_Anks 1161..1305 CDD:269972 73/153 (48%)
ANKS1BNP_001339115.1 ANK repeat 7..56 CDD:293786 18/49 (37%)
ANK 53..181 CDD:238125 72/128 (56%)
ANK repeat 58..89 CDD:293786 20/31 (65%)
ANK repeat 91..125 CDD:293786 15/34 (44%)
ANK 122..246 CDD:238125 75/145 (52%)
ANK repeat 127..158 CDD:293786 17/31 (55%)
ANK repeat 160..191 CDD:293786 19/32 (59%)
ANK repeat 193..223 CDD:293786 19/50 (38%)
ANK repeat 226..256 CDD:293786 18/30 (60%)
SAM_AIDA1AB-like_repeat1 811..877 CDD:188898 21/68 (31%)
SAM_AIDA1AB-like_repeat2 882..946 CDD:188899 24/83 (29%)
PTB_Anks 1071..1220 CDD:269972 72/153 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0507
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 472 1.000 Inparanoid score I1494
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D252573at33208
OrthoFinder 1 1.000 FOG0001275
OrthoInspector 1 1.000 T130253
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24174
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.940

Return to query results.
Submit another query.