DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4393 and anks1b

Sequence 1:NP_001287483.1 Gene:CG4393 FlyBaseID:FBgn0039075 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_017210541.1 Gene:anks1b ZFINID:ZDB-GENE-041210-349 Length:1281 Species:Danio rerio

Alignment Length:1453 Identity:435/1454 (30%)
Similarity:627/1454 (43%) Gaps:382/1454 (26%)


  Fly     1 MGKDQEFLEAARNGNISHIEKVLTQKAKRAGP---------LASLRRGTGVNVQDSGGYSALHHA 56
            |||:||.|||||.||:..:||:|:.|....|.         |.|:.||..||..|..||:.||||
Zfish     1 MGKEQELLEAARTGNVGLVEKLLSGKKGLLGSGSGSIPLPGLLSMWRGLNVNCVDGSGYTPLHHA 65

  Fly    57 CLNGHEDIVRLLLAHEASPNLPDSRGSSPLHLAAWAGETEIVRLLLTHPYRPASANLQTIEQETP 121
            .||||.|:|..||..|||.|:.||:|..|||||||.|:.:||::|:.|....:..|.|.:|:||.
Zfish    66 SLNGHRDVVLKLLQFEASTNVSDSKGCFPLHLAAWRGDVDIVQILIHHGPSHSRVNEQNLEKETA 130

  Fly   122 LHCAAQHGHTGALALLLHHDADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAHLGTEAL 186
            ||||||:||:..:.:||....||:||||||||||||||.|||||.|:||:.|||.|:: ..|.  
Zfish   131 LHCAAQYGHSEVVRVLLQELTDPSMRNSRGETPLDLAALYGRLQVVRMLLTAHPNLMS-CNTR-- 192

  Fly   187 ERGTPSPSSPASPSRAIFPHTCLHLASRNGHKSVVEVLLSAGVSVNLLTPSGTALHEAALCGKEN 251
                              .||.||||:||||.:.|:|||.|.:.||..|..|:|||||||.||.:
Zfish   193 ------------------KHTPLHLAARNGHYATVQVLLEADMDVNTQTEKGSALHEAALFGKMD 239

  Fly   252 VVRTLLKAGINLNATDNEGRTALDILREFPPHVTKHIVAVINNFRNQMDTDEGDEVIYRQHSGPP 316
            ||:.||.:||:.|..|.:||||||||||.|...::.|.::|:::. ..|.|.|:           
Zfish   240 VVQLLLDSGIDANIRDCQGRTALDILREHPSQKSQQIASLIHDYM-MSDCDRGN----------- 292

  Fly   317 NSGRGQNKHHSQQQPPLSNHYHFNSNNHLLNHSHSMQQSGYSKQRLSAGNGGPYNGGKSLDSALQ 381
                                                                             
Zfish   293 ----------------------------------------------------------------- 292

  Fly   382 PEDRFYQDLNAHSPLHSQNEMGGGYSVSPSSSLSSFEPA-SVSPRSRCSTGGLGQPMHMSTFAPA 445
                |::||..|.|:           .:|.:|:.|..|: |:..::...||.|.:.::.....  
Zfish   293 ----FHEDLARHRPI-----------PTPRTSIPSPVPSPSLRHKNDAVTGELSKLLNEIKIC-- 340

  Fly   446 GPPKKPPRRNLSVSPTHAGPGQQFSYSSPSSQSQSQSHGHGQNQVRRQPASESPYSHQSHGSVGG 510
                    |:...|         |.....:..|.|||.                           
Zfish   341 --------RDKDCS---------FEELCQTISSHSQSM--------------------------- 361

  Fly   511 MSFDETQLRERQRNDRLYASARQSTRSAIAGGMSLSSSNDMLDRQCSSSELNSETSVPNSSGDSP 575
            .||...:|.:.:||..|....::.|       ..|..:.:..::.|..|.| .|...|.:...:.
Zfish   362 ESFGSGRLSDEERNGTLTRINKRPT-------PPLPPALEEEEKSCGPSGL-WEALTPCNGCRNL 418

  Fly   576 ATNSMKRPIPAPRSSTTKL------SKELLKSAESATLK----SYNPNRKLKRNRNSS--GANGA 628
            ..:..||.:....|.:..:      .......|.:.|.|    ..|.:....||.:.|  ..:.|
Zfish   419 GFSQDKRCVEIAHSPSLDVFLPEDEDNPYESVATAVTRKPCSLDINLHNACPRNGHFSHVSVSDA 483

  Fly   629 AKSNGGDENCEAKQQIPSSPTHYKQPPTPDHPPPSSSQAERTIHERIRPLSQEYKRRSALLQLQA 693
            .:.|.||::...               |||..|||...|.|.|...|||   :.|:|::|...|.
Zfish   484 ERGNHGDDSTGL---------------TPDCSPPSPDTALRNIERVIRP---QPKQRTSLSSSQD 530

  Fly   694 AQQLMIETGSSPSKLLPTLSTPGYDYDDTVTVVPRCPAPSSGSLSSSISCSDHSLSHSTDYVEEF 758
            .|:.:......||::..:|.     |....|..|..| |.|.:..|:.|..|::|:....|.:|.
Zfish   531 VQKPLQNHSGDPSEVSSSLG-----YASFSTSPPASP-PISPANCSTGSAEDYALTDEATYQKEC 589

  Fly   759 V-------SDVP--FAGLLKGASQQLKEQP----EVKLKIQEESKPQQTL--------PRVRPPI 802
            :       |.||  |||||.|:|... |.|    ::..|:::.|.|:..|        |...||.
Zfish   590 IERDDRRNSHVPEQFAGLLHGSSPAC-ESPDNPYQLYGKVRKFSVPEPPLRHGNFLRAPEYSPPF 653

  Fly   803 P----TKPAIPEKKFAKPPT-------TPTNQ-----------------------------SLEA 827
            |    ...|:..::..||..       |..||                             |..|
Zfish   654 PRTGSEASALKTQREVKPQVVYRTIFHTRVNQGPVTFGEQVDKTTGVHARNGEARSNCTGGSSPA 718

  Fly   828 NGNSSSD----------------VVIKPPRSPSKSPSKTSNKSPVK----------SPGKSPAKS 866
            |.|:..:                :.::..|:.|||.|.....||::          |||||   |
Zfish   719 NSNTGYEERACTLGRMRSMPKNVLDLQLSRNFSKSDSNLVAVSPIEEEQWGSRGQSSPGKS---S 780

  Fly   867 PGSGHSAARNSINLLSPFNAEEARKKISEIIENFGSGILN--TSITPTHDIELDFEDMEVPNER- 928
            |        :.:.....|.||  .::|.:|:.:.|:||..  ..||..|           |..| 
Zfish   781 P--------SRLERTPSFTAE--WEEIDKIMSSIGAGIGTEMEGITEDH-----------PGPRC 824

  Fly   929 --RELATRLRAAGLLHLERILFENGYDNYKFV-NNVFEEPD---IPLLHIPERDAPKLLRFVQSL 987
              :.:...|...||:..|..|..||:||.:|: :||.|:.|   |.:|:...|.  :||:.::.|
Zfish   825 PVQSVGQWLDNIGLVQYENHLLSNGFDNVQFMGSNVVEDQDLLEIGILNSAHRQ--RLLQAIRLL 887

  Fly   988 PPAEFQPQVPVKTQQENKQMGVATLQQWLNTIALPEYLEFFNKHLYNTIESVCGVWDVELQTVLE 1052
            |...     |:.....|.    .::.:||.::.|.:|.:.|..:.|.::|.|..:|::||..||:
Zfish   888 PRVR-----PIGYDGNNP----TSVAEWLESLELGDYTKSFLINGYTSMELVKKIWEIELINVLK 943

  Fly  1053 INKLGHRRRILQSLAYIRQMRDSDSK-----SQKTPLGENNETNQLTTNGNGTAREAPPRLPANP 1112
            ||.:|||:|||.||. .|...|...|     |.:.|.| |:...||:.    :..:|.|...:..
Zfish   944 INLIGHRKRILASLG-DRLHEDPPQKPPRAISLREPTG-NHTPPQLSP----SLSQAYPNAGSLD 1002

  Fly  1113 VHHRNSITGYRKSRP----APPPPAPPARKTA----------ALQIRAPSELLLGLPANLRTTEW 1163
            |.|.......|:.|.    ...|.:...|:.|          .:.:|.|:|.....|...    |
Zfish  1003 VQHLIMQADARRRRNDNYFEDVPRSKLERQMAQVSMQGEWCEPITLRPPNEATSSTPVQY----W 1063

  Fly  1164 RHSAQTLLNEHINYEVQYLGSTVVKELRGTESTKKSIQKLKTSADGEVKSGSPLSLAICHRGVEF 1228
            :|..:.|:.:..:||..||||.:||||||||||..:..|::.|.: ::|....:.|::.::||:|
Zfish  1064 QHHPEKLIFQSCDYEAYYLGSMLVKELRGTESTHDACAKMRKSTE-QMKKIPTIVLSVSYKGVKF 1127

  Fly  1229 KDVNSKRTICEHEIQNINCACQDSEDLRHFAYITKE--QDLHYCHVFLVESTDLASEIILTLGQA 1291
            .|..:|..|.||||:||:||.||.|||..||||||:  ...||||||.....:||.|||||||||
Zfish  1128 IDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSSHHYCHVFTAFDVNLAYEIILTLGQA 1192

  Fly  1292 FEVAYQLALR-----DGITTTPE 1309
            |||||||||:     .|.:|.||
Zfish  1193 FEVAYQLALQARKSGHGSSTLPE 1215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4393NP_001287483.1 Ank_2 <10..79 CDD:289560 35/78 (45%)
ANK 43..171 CDD:238125 74/128 (58%)
ANK repeat 49..79 CDD:293786 18/30 (60%)
Ank_2 53..148 CDD:289560 50/95 (53%)
ANK repeat 81..115 CDD:293786 15/34 (44%)
ANK 112..257 CDD:238125 75/145 (52%)
ANK repeat 117..148 CDD:293786 17/31 (55%)
Ank_2 122..233 CDD:289560 56/111 (50%)
ANK repeat 181..233 CDD:293786 18/52 (35%)
Ank_5 224..276 CDD:290568 30/52 (58%)
ANK repeat 237..267 CDD:293786 17/30 (57%)
SAM_AIDA1AB-like_repeat2 1005..1069 CDD:188899 23/64 (36%)
SAM 1009..1075 CDD:197735 25/66 (38%)
PTB_Anks 1161..1305 CDD:269972 75/151 (50%)
anks1bXP_017210541.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0507
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 493 1.000 Inparanoid score I1334
OMA 1 1.010
OrthoDB 1 1.010 D252573at33208
OrthoFinder 1 1.000 FOG0001275
OrthoInspector 1 1.000 T128775
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24174
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.940

Return to query results.
Submit another query.