DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4393 and si:ch211-119c20.2

Sequence 1:NP_001287483.1 Gene:CG4393 FlyBaseID:FBgn0039075 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_009304988.1 Gene:si:ch211-119c20.2 ZFINID:ZDB-GENE-041001-137 Length:1308 Species:Danio rerio

Alignment Length:1511 Identity:343/1512 (23%)
Similarity:524/1512 (35%) Gaps:522/1512 (35%)


  Fly     1 MGKDQEFLEAARNGNISHIEKVLTQ-KAKRAGPLASLRRGTGVNVQDSGGYSALHHACLNGHEDI 64
            |||:|:.|.|.:||::....|:|.: |..|...|.|.:| ..||.||..|:||||||.|.|..|:
Zfish     1 MGKEQDLLLAVKNGDLPLAHKLLAKIKTNRNKLLGSTKR-LNVNYQDQDGFSALHHAALTGTTDL 64

  Fly    65 VRLLLAHEASPNLPDSRGSSPLHLAAWAGETEIVRLLLTHPYRPASANLQTIEQETPLHCAAQHG 129
            :.|||..:|:.::.||.|..|||.|||.|:.:.|.|||.   ..||.|..:.:.:.|||.|||:|
Zfish    65 LSLLLEAQATVDIKDSNGMRPLHYAAWQGKADSVLLLLR---AGASVNGASHDGQIPLHLAAQYG 126

  Fly   130 HTGALALLLHHDADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAHLGTEALERGTPSPS 194
            |.....:||.|.::|...|...:||||||.::|||:..|:|:.::..:       ||..|....:
Zfish   127 HYDVSEMLLQHQSNPCTVNKVKKTPLDLACEFGRLKVTQLLLNSNMVV-------ALLEGNGRDN 184

  Fly   195 SPASPSRAIFPHTCLHLASRNGHKSVVEVLLSAGVSVNLLTPSGTALHEAALCGKENVVRTLLKA 259
            :|            ||||:|||||.::.:||.||:.:|..|.||||||||||.||..||:.||.|
Zfish   185 TP------------LHLAARNGHKDIIRLLLKAGIDINRTTKSGTALHEAALYGKTEVVKLLLDA 237

  Fly   260 GINLNATDNEGRTALDILREF-PPHVTKHI------------VAVINNFRNQMDTD-----EGDE 306
            ||::|..:...:|||||:.:| ..|.:|.|            |..:.::.|..|..     .||.
Zfish   238 GIDVNIRNTYNQTALDIVNQFTTSHASKEIKQLLRDASGALQVRALKDYWNLHDPTALNIRAGDV 302

  Fly   307 V-IYRQHSG--------------------PPN--------SGRGQN--------KHH--SQQQPP 332
            : :..||..                    ||:        ||.|.:        :||  |:..|.
Zfish   303 ITVLEQHMDGRWKGHIHDSQRGTDRVGFFPPSIVEVISRRSGGGLSRQASLPVQRHHILSRALPS 367

  Fly   333 LSNHY--H-------FNSNNHLLNHSHSMQQ---------------------------------- 354
            .::|:  |       ::|.:..:.|.:|:.|                                  
Zfish   368 HNSHHTSHTDDSYTLYSSTHPTVTHHNSLDQHSGALPDSPSALCKPEDIWVLRTSLNAGDRNSIG 432

  Fly   355 -SGYSKQRLSAGNGG------PYNGGKSLDSALQPEDRF----------YQDLNAHSPLHS---- 398
             :|......|||:|.      |.||.....||:|...:.          .||...|...||    
Zfish   433 SAGSMGSSRSAGSGQSTEGNFPNNGPYQSPSAVQDNSKMPPSAGELLEQNQDPTKHMDPHSGALG 497

  Fly   399 ---------------------------------------------------------QNEMGGGY 406
                                                                     .|.:..||
Zfish   498 RRIPLSSSRPGEQHVIHQQLLLDGRHTSKQINAVKRALRDAEAIYQWLCEFQLEQYTSNFLTAGY 562

  Fly   407 SVSPSSSLSSFEPASV---SPRSR----CSTGGLGQPMHMSTFAPA---------GPP--KKPPR 453
            .|...|.::..:..::   .|..|    ...|.|..|..:..:.|:         |.|  :|...
Zfish   563 DVPTISRMTPEDLTAIGVTKPGHRKKISMEIGNLNIPEWLPDYIPSDIGKWLSAIGLPQYQKKLA 627

  Fly   454 RN----------------LSVSPTHAGPGQQF-----SYSSPSSQSQSQSHGHGQNQVRRQP--- 494
            .|                ..:..|..|..::.     ..|......::|:.|....|.|:.|   
Zfish   628 ENGYDSISIVQDITWEDLQEIGITKLGHQKKLMLAVKRLSDVQKARKTQAEGQALLQHRKAPPAL 692

  Fly   495 ---------ASESPYSHQSHGSVGGMSFDETQLRERQRNDRLYASARQSTRSAIAGGMSLSSSND 550
                     .|:.|.|..|...   ::|.:::|....:|        ...||..:||....|.:.
Zfish   693 ELVAIEHHDTSDCPSSPLSPKM---LTFQDSELSMELQN--------AMARSGYSGGQDGLSMSG 746

  Fly   551 MLDRQCSSSELNSETSVPNSSGDSPATNSMKRPIPA--PRSSTTKLSKELLKSAESATLKSYNPN 613
            :..|.       |:.|:...||.|  ..|.:||:.:  |.|.    |:|.|.|::|      :|:
Zfish   747 IAMRL-------SQESIGIRSGGS--GRSQERPMASVTPHSR----SQESLGSSDS------SPS 792

  Fly   614 RKLKRNRNSSGANGAAKSNGGDENCEAKQQIPSSPTHYKQP-PTPDHPPPSSSQAERT------- 670
            ::....|.|                :.|.||  ||...... |...||..|||...||       
Zfish   793 KEQYAIRES----------------QDKSQI--SPVRMAPVLPLQPHPNSSSSSPSRTPPILTGK 839

  Fly   671 --------IHERIRPL--------SQEYKRRSALLQLQ-------------AAQQLMIETGSSPS 706
                    ||.:.||:        ....:|..:.||.|             .|.|...:|..|..
Zfish   840 TTRFAYPPIHTQSRPVVSPSQPNQGSPLQRGFSYLQHQNCDANKQKNTGPVRAAQPNQDTSCSTK 904

  Fly   707 KLLPTLS----TPGYDYDDTVTVVPRCPAPSSGSLSSSISCSDHSLSHSTDYVEEFVSDVPFAGL 767
            |...:||    :.|.:.||.|:    .|..:|.:::|                        :|.|
Zfish   905 KRTQSLSRYAMSDGENEDDDVS----APTMTSANVAS------------------------YATL 941

  Fly   768 LKGASQQLKEQPEVKLKIQEESKPQQTLPRVR---PPIPTKPAIPEKKFAKPPTTPTNQSLEANG 829
            .:...   :.||...|..:...:......|.:   ||.|     |.|:.:...:..|:..:|...
Zfish   942 TRKPG---RSQPSFALSDRHVGRSHSFAIRAKRKGPPPP-----PPKRLSSAQSGVTSCGVETES 998

  Fly   830 NSSSDVVIKPPRSPSKSPSKTSNKSPVKSPGKSPAKSPGSGHSAARNSINLLSPFNAEEARKKIS 894
            ..|...:.....|.:.|||||.| ||| ....|||..|.:..:..|.:.: .|.:..:.|.:.:|
Zfish   999 AGSVRSIAARLESSTGSPSKTCN-SPV-FKAMSPATPPKNTENRRRTTSD-CSTYETKHADQNVS 1060

  Fly   895 EIIENFGSGILNTSITPTHDIELDFEDMEVPNERRELATRLRAAGLLHLERILFENGYDNYKFVN 959
            .:....|||....||....:.::..:      :|.:||:....|          |...|..|...
Zfish  1061 PLRHQQGSGSSQESIPFAEEGKVTIK------QRTKLASAKSEA----------EAAVDILKPAQ 1109

  Fly   960 NVFEEPDIPLLHIPERDAPKLLRFVQSLPPAEFQPQVPVKTQQENKQMGVATLQQWLNTIALPEY 1024
            ::....::...::.|.|..|     :...|.|.|    :|.|..:.|:|                
Zfish  1110 SIKSSLEVLEFNLKESDTVK-----RRHKPKELQ----MKGQGISAQIG---------------- 1149

  Fly  1025 LEFFNKHLYNTIESVCGVWDVELQTVLEINKLGHRRRILQSLAYIRQMRDSDSKSQKTPLGENNE 1089
                |:..            .|.:.||:..:.|..|                    |.||     
Zfish  1150 ----NERA------------TETEMVLQCMQNGGLR--------------------KNPL----- 1173

  Fly  1090 TNQLTTNGNGTAREAPPRLPANPVHHRNSITGYRKSRPAPPPPAPPARKTA-------------- 1140
                   .:|.|    |: |.:|  |:            ||.|:.|.|.:|              
Zfish  1174 -------KSGLA----PK-PGSP--HK------------PPTPSKPIRHSAAATSGVSMSVVQSV 1212

  Fly  1141 ALQIRAPSELLLGLPANLRTTEWRHSAQTLLNEHINYEVQYLGSTVVKELRGTESTKKSIQKLKT 1205
            |..:..|...|...|.|  .|....||.|...:::         .|.|.|   |.|..|:|....
Zfish  1213 AFAVSPPCSPLACCPPN--ATPQGQSALTAEGQNV---------LVHKRL---EQTSTSLQAALQ 1263

  Fly  1206 SADGEVKSGSPLSLAI 1221
            ..:.::....|.|..|
Zfish  1264 VVERKLAQDDPASRGI 1279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4393NP_001287483.1 Ank_2 <10..79 CDD:289560 28/70 (40%)
ANK 43..171 CDD:238125 58/128 (45%)
ANK repeat 49..79 CDD:293786 14/30 (47%)
Ank_2 53..148 CDD:289560 40/95 (42%)
ANK repeat 81..115 CDD:293786 15/34 (44%)
ANK 112..257 CDD:238125 59/145 (41%)
ANK repeat 117..148 CDD:293786 12/31 (39%)
Ank_2 122..233 CDD:289560 41/111 (37%)
ANK repeat 181..233 CDD:293786 18/52 (35%)
Ank_5 224..276 CDD:290568 30/52 (58%)
ANK repeat 237..267 CDD:293786 20/30 (67%)
SAM_AIDA1AB-like_repeat2 1005..1069 CDD:188899 8/64 (13%)
SAM 1009..1075 CDD:197735 6/66 (9%)
PTB_Anks 1161..1305 CDD:269972 14/62 (23%)
si:ch211-119c20.2XP_009304988.1 Ank_4 7..69 CDD:290365 27/63 (43%)
ANK repeat 7..46 CDD:293786 14/40 (35%)
ANK 43..168 CDD:238125 58/128 (45%)
ANK repeat 48..79 CDD:293786 14/31 (45%)
Ank_2 53..145 CDD:289560 40/95 (42%)
ANK repeat 81..112 CDD:293786 15/34 (44%)
ANK 114..235 CDD:238125 58/140 (41%)
ANK repeat 114..145 CDD:293786 12/31 (39%)
Ank_2 152..245 CDD:289560 48/112 (43%)
ANK repeat 158..213 CDD:293786 23/74 (31%)
ANK repeat 215..245 CDD:293786 20/30 (67%)
ANK repeat 247..281 CDD:293786 10/34 (29%)
SH3_Caskin2 278..339 CDD:212996 9/61 (15%)
Caskin1-CID 414..>451 CDD:293208 5/37 (14%)
SAM_caskin1,2_repeat1 536..600 CDD:188896 10/64 (16%)
SAM 537..589 CDD:197735 7/52 (13%)
SAM_caskin1,2_repeat2 601..671 CDD:188897 8/70 (11%)
SAM 607..668 CDD:197735 8/61 (13%)
Caskin-Pro-rich 904..991 CDD:293512 22/123 (18%)
Caskin-tail 1248..1308 CDD:293238 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.