DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4393 and Anks1b

Sequence 1:NP_001287483.1 Gene:CG4393 FlyBaseID:FBgn0039075 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001258300.1 Gene:Anks1b RGDID:1565556 Length:1256 Species:Rattus norvegicus

Alignment Length:1473 Identity:428/1474 (29%)
Similarity:612/1474 (42%) Gaps:438/1474 (30%)


  Fly     1 MGKDQEFLEAARNGNISHIEKVLTQK-----AKRAGP-----LASLRRGTGVNVQDSGGYSALHH 55
            ||||||.|||||.||::.:||:|:.:     ...:||     |.|:.||..||..||.||:||||
  Rat     1 MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGYTALHH 65

  Fly    56 ACLNGHEDIVRLLLAHEASPNLPDSRGSSPLHLAAWAGETEIVRLLLTHPYRPASANLQTIEQET 120
            |.||||:|||..||..|||.|:.|::|..|:|||||.|:.|||::|:.|....:..|.|..|.||
  Rat    66 AALNGHKDIVLKLLQFEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSRVNEQNNENET 130

  Fly   121 PLHCAAQHGHTGALALLLHHDADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAHLGTEA 185
            .||||||:||:..:|:||....||.:|||:.||||||||.||||:.|:|:|.|||.|:: ..|. 
  Rat   131 ALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMIISAHPNLMS-CNTR- 193

  Fly   186 LERGTPSPSSPASPSRAIFPHTCLHLASRNGHKSVVEVLLSAGVSVNLLTPSGTALHEAALCGKE 250
                               .||.||||:|||||:||:|||.||:.|:..|..|:|||||||.||.
  Rat   194 -------------------KHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKV 239

  Fly   251 NVVRTLLKAGINLNATDNEGRTALDILREFPPHVTKHIVAVINNFRNQMDTDEG---DEVIYRQH 312
            :|||.||:.||:.|..|:.|||.||||:|.|...:..|..::.::.      ||   ..|:..:|
  Rat   240 DVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQDYL------EGVGRSVVLEEEH 298

  Fly   313 SGPPNSGRGQNKHHSQQQPPLSNHYHFNSNNHLLNHSHSMQQSGYSKQRLSAGNGGPYNGGKSLD 377
            :          :..:.|:..||                |..||...|.:.....|   ...|.||
  Rat   299 A----------QEDTAQETRLS----------------SPAQSPSQKTKSETVTG---ELSKLLD 334

  Fly   378 --SALQPEDRFYQDLNAHSPLH--------SQNEMG--GGYSVSPSSSLSSFEPASV-----SPR 425
              ...|.:|..::||......|        |:.|:|  |..||..||:: :..|..|     .|.
  Rat   335 EIKLCQEKDYSFEDLCHTISDHYLDNLSKISEEELGKNGSQSVRTSSTI-NLSPGEVEDEEEDPN 398

  Fly   426 SRCSTG------------GLGQPMHMSTFAPAGPPKKPPRRNLSVSPTHAGPGQQFSYSSPSSQS 478
            |...||            .||.||    .|....|||                            
  Rat   399 SCGPTGLWEALTPCNGCRNLGFPM----LAQESYPKK---------------------------- 431

  Fly   479 QSQSHGHGQNQVRRQPASESPYSHQSHGSVGGMSFDETQLRERQRNDRLYASARQSTRSAIAGGM 543
                        |..|....|                              ||...|..      
  Rat   432 ------------RNYPMEIVP------------------------------SASLDTFP------ 448

  Fly   544 SLSSSNDMLDRQCSSSELNSETSVPNSSGDSPAT-NSMKRPIPAPRSSTTKLSKELLKSAESATL 607
              |.:.:.|.....::......|:..:...||.| |:.:..|.||.:.                 
  Rat   449 --SENENFLCELVDTAVTKKPCSLEIARAPSPRTDNASEVAITAPGTG----------------- 494

  Fly   608 KSYNPNRKLKRNRNSSGANGAAKSNGGDENCEAKQQIPSSPTHYKQPPTPDHPPPSSSQAERTIH 672
                      .:||||..                             ||||..|||...|.:.|.
  Rat   495 ----------HHRNSSTG-----------------------------PTPDCSPPSPDTALKNIV 520

  Fly   673 ERIRPLSQEYKRRSALLQL--------QAAQQLMIETGSSPSKLLPTLSTPGYDYDDTVTVVPRC 729
            :.|||  |..:|.|.:..|        |...::...||.:.....|.:|.|              
  Rat   521 KVIRP--QPKQRTSIVSSLDFQRMNHNQEYFEISTSTGCTSFTSSPPVSPP-------------- 569

  Fly   730 PAPSSGSLSSSISCSD---HSLSHSTDYVEEFVSDVP-------FAGLLKGASQQLKEQPEVKLK 784
                    :||:..::   ....|:.|..::...:.|       |||||.|:|... |.||....
  Rat   570 --------TSSVETTEIKNEGAEHTDDLSQQEDDEPPKEYDAGQFAGLLHGSSPAC-EAPENPFH 625

  Fly   785 I-----------QEESKPQQTLPRVRPPIPTKPAIPEKKFAKPPT----------------TPTN 822
            :           :|.|.....||..:.||...|. |..|..||..                |...
  Rat   626 LYGKRNQGEDGQEEASLANSPLPFKQTPIENNPE-PSVKKIKPKVVSRTIFHKRSHQLENHTIVG 689

  Fly   823 QSLEANGNSSSDV-VIKP----------------PRS-----PSKSPSKTSNKSPVKSPGKSPAK 865
            ..:...|:.:.|. .:.|                |::     .||:.|| |:...:..|.|..|:
  Rat   690 TRMSRGGSRNGDQWGVNPGGFVERACTLGRIRSLPKALIDMHLSKNVSK-SDSDLIAYPSKDKAR 753

  Fly   866 SPGSGHSAARNSINLLSPFNAEEAR------KKISEIIENFGSGILNTSITPTHDIELDFEDMEV 924
            ...|..|.|..|    |..|:|...      ::|.:|:.:...|           |..:.|.|..
  Rat   754 VNWSKSSTAERS----SKDNSERTPSFTSEWEEIDKIMNSIDVG-----------INSELEGMNG 803

  Fly   925 PN-ERRELATRLRAAGLLHLERILFENGYDNYKFV-NNVFEEPD---IPLLHIPERDAPKLLRFV 984
            |. ..:.:...|.:.||...|..|..||:||.:|: :||.|:.|   |.:|:...|.  ::|:.:
  Rat   804 PRCPVQTVGQWLESIGLPQYENHLTANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQ--RILQAI 866

  Fly   985 QSLPPAE------FQPQVPVKTQQENKQMGVATLQQWLNTIALPEYLEFFNKHLYNTIESVCGVW 1043
            |.||...      :.|               .::.:||::|.|.:|.:.|..:.|.:::.:..:|
  Rat   867 QLLPKMRPIGHDGYHP---------------TSVAEWLDSIELGDYTKAFLINGYTSMDLLKKIW 916

  Fly  1044 DVELQTVLEINKLGHRRRILQSLAYIRQMRDSDSKSQKT-----PLGENNETNQL---------T 1094
            ::||..||:|:.:|||:|||.||. .|...|...|..::     |.| |:...||         |
  Rat   917 ELELINVLKISLIGHRKRILASLG-DRLHEDPPQKPPRSITLREPSG-NHTPPQLSPSLSQSTYT 979

  Fly  1095 TNGN---------GTAREAPPR-----LPANPVHHRNSITGYRKSRPAPPPPAPPARKTAALQIR 1145
            |.|:         |.||.....     :|.:.:..:.:.|| ....|             ::.:|
  Rat   980 TGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQTG-DWGEP-------------SITLR 1030

  Fly  1146 APSELLLGLPANLRTTEWRHSAQTLLNEHINYEVQYLGSTVVKELRGTESTKKSIQKLKTS---A 1207
            .|:|.....|...    |:|..:.|:.:..:|:..||||.::|||||||||:.:..|::.:   :
  Rat  1031 PPNEATASTPVQY----WQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKS 1091

  Fly  1208 DGEVKSGSPLSLAICHRGVEFKDVNSKRTICEHEIQNINCACQDSEDLRHFAYITKE--QDLHYC 1270
            ..::|....:.|::.::||:|.|..:|..|.||||:||:||.||.|||..||||||:  .:.|||
  Rat  1092 TEQMKKVPTIILSVSYKGVKFIDAANKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYC 1156

  Fly  1271 HVFLVESTDLASEIILTLGQAFEVAYQLAL--RDG--ITTTPE 1309
            |||.....:||.||||||||||||||||||  |.|  .:|.||
  Rat  1157 HVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPE 1199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4393NP_001287483.1 Ank_2 <10..79 CDD:289560 38/79 (48%)
ANK 43..171 CDD:238125 72/128 (56%)
ANK repeat 49..79 CDD:293786 20/30 (67%)
Ank_2 53..148 CDD:289560 50/95 (53%)
ANK repeat 81..115 CDD:293786 15/34 (44%)
ANK 112..257 CDD:238125 75/145 (52%)
ANK repeat 117..148 CDD:293786 17/31 (55%)
Ank_2 122..233 CDD:289560 55/111 (50%)
ANK repeat 181..233 CDD:293786 20/52 (38%)
Ank_5 224..276 CDD:290568 30/52 (58%)
ANK repeat 237..267 CDD:293786 18/30 (60%)
SAM_AIDA1AB-like_repeat2 1005..1069 CDD:188899 21/64 (33%)
SAM 1009..1075 CDD:197735 23/66 (35%)
PTB_Anks 1161..1305 CDD:269972 73/153 (48%)
Anks1bNP_001258300.1 ANK 1 2..31 15/29 (52%)
Ank_4 7..79 CDD:290365 35/72 (49%)
ANK repeat 7..56 CDD:293786 18/49 (37%)
ANK 53..181 CDD:238125 72/128 (56%)
ANK repeat 58..89 CDD:293786 20/31 (65%)
ANK 2 58..87 20/29 (69%)
Ank_2 63..158 CDD:289560 50/95 (53%)
ANK repeat 91..125 CDD:293786 15/34 (44%)
ANK 3 91..120 13/29 (45%)
ANK 122..246 CDD:238125 75/145 (52%)
ANK repeat 127..158 CDD:293786 17/31 (55%)
ANK 4 127..156 16/29 (55%)
ANK repeat 160..191 CDD:293786 19/32 (59%)
ANK 5 160..189 19/29 (66%)
Ank_2 165..256 CDD:289560 55/112 (49%)
ANK repeat 193..223 CDD:293786 19/50 (38%)
ANK 6 193..222 19/49 (39%)
ANK 7 225..254 18/29 (62%)
ANK repeat 226..256 CDD:293786 18/30 (60%)
SAM 804..869 CDD:197735 20/67 (30%)
SAM_AIDA1AB-like_repeat1 807..873 CDD:188898 21/68 (31%)
SAM_AIDA1AB-like_repeat2 878..942 CDD:188899 22/80 (28%)
SAM 878..939 CDD:197735 21/76 (28%)
Nuclear localization signal. {ECO:0000250} 931..934 2/3 (67%)
PTB_Anks 1042..1191 CDD:269972 72/153 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0507
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 470 1.000 Inparanoid score I1433
OMA 1 1.010
OrthoDB 1 1.010 D252573at33208
OrthoFinder 1 1.000 FOG0001275
OrthoInspector 1 1.000 T131268
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24174
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.