DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4393 and Caskin1

Sequence 1:NP_001287483.1 Gene:CG4393 FlyBaseID:FBgn0039075 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_006245957.1 Gene:Caskin1 RGDID:620191 Length:1437 Species:Rattus norvegicus

Alignment Length:1377 Identity:313/1378 (23%)
Similarity:506/1378 (37%) Gaps:392/1378 (28%)


  Fly     1 MGKDQEFLEAARNGNISHIEKVLTQ----KAKRAGPLASLRRGTGVNVQDSGG-------YSALH 54
            |||:||.::|.:..::...:::|.:    |||..|....:    .||.||..|       :||||
  Rat     1 MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKI----NVNFQDPDGPVLHLPSFSALH 61

  Fly    55 HACLNGHEDIVRLLLAHEASPNLPDSRGSSPLHLAAWAGETEIVRLLLTHPYRPASA-NLQTIEQ 118
            ||.|||:.:::.|||..:|:.::.|::|..|||.|||.|..|.::|:|    :..|| |:.:.|.
  Rat    62 HAALNGNTELISLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVL----KAGSAVNVPSDEG 122

  Fly   119 ETPLHCAAQHGHTGALALLLHHDADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAHLGT 183
            ..|||.||||||.....:||.|.::|.|.::.|:||||||.::||:..||:|      |.:::..
  Rat   123 HIPLHLAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLL------LSSNMCA 181

  Fly   184 EALERGTPSPSSPASPSRAIFPHTCLHLASRNGHKSVVEVLLSAGVSVNLLTPSGTALHEAALCG 248
            ..||   |.|.....|:..    :.||||::|||..::.:||.||:.:|..|.||||||||||||
  Rat   182 ALLE---PRPGDTTDPNGT----SPLHLAAKNGHIDIIRLLLQAGIDINRQTKSGTALHEAALCG 239

  Fly   249 KENVVRTLLKAGINLNATDNEGRTALDILREF-PPHVTKHIVAVI----------------NNF- 295
            |..|||.||.:|||....:...:|||||:.:| ....:|.|..::                ||: 
  Rat   240 KTEVVRLLLDSGINAQVRNTYSQTALDIVHQFTTSQASKEIKQLLREASAALQVRATKDYCNNYD 304

  Fly   296 RNQMDTDEGDEV-IYRQHSGPPNSGRGQNKHHSQQQPPLSNHYHFNSNNHLLNHSHSMQQSGYSK 359
            ...::...||.: :..||.    .||.:...|..:          ..|:.:.....|:.::...:
  Rat   305 LTSLNVKAGDIITVLEQHP----DGRWKGCIHDNR----------TGNDRVGYFPSSLGEAIVKR 355

  Fly   360 QRLSAGN-GGPYNGGKSLDSALQPEDRFYQDLNAHSPLHSQNEMGGGYSVSPSSSLSSFEPASVS 423
            .....|: ..|..||.||..:..||:.:.          .:....||   ..|.|||:.....  
  Rat   356 AGSRTGSEPSPPQGGGSLGPSAPPEEIWV----------LRKPFAGG---DRSGSLSNVAGGR-- 405

  Fly   424 PRSRCSTGGLGQPMH-----------------MSTFAPAGPPKKPPRRNLSVS---PTHAGPGQQ 468
                 |||  |..:|                 :|..:|...|.|||..:...:   |..|..||.
  Rat   406 -----STG--GHALHAGAEGVKLLATVLSQKSVSESSPGDSPVKPPEGSSGAARSQPPAAHAGQV 463

  Fly   469 FSYSSPSS-QSQSQSHGHGQNQVRRQPASESPYSHQSHGSVGGMSFDETQLRERQRNDRLYASAR 532
            :....|.. :|.|.|.|.....|.:..|:.....:..:.:..|  :|            |...:|
  Rat   464 YGEQPPKKLESSSASEGKSAEAVSQWLATFQLQLYAPNFTSAG--YD------------LPTISR 514

  Fly   533 QSTRSAIAGGMSLSSSNDMLDRQCSSSELNSETSVPNSSGDSPATNSMKRPI------------- 584
            .:.....|.|::.......:..:.|.  ||....:|.   ..||..::...:             
  Rat   515 MTPEDLTAIGVTKPGHRKKITAEISG--LNIPDCLPE---HKPANLAVWLSMIGLAQYYKVLVDN 574

  Fly   585 --------------PAPRSSTTKL--SKELLKSAESATLKSYNPNRKLKRNRNSSGANGAAKSNG 633
                          .......|||  .|:|:.:.           |||...:.:.    .:|..|
  Rat   575 GYENIDFITDITWEDLQEIGITKLGHQKKLMLAV-----------RKLAELQKAE----YSKYEG 624

  Fly   634 GDENCEAKQQIPSSPTHYKQPPTPDHPPPSSSQAERTIHERIRPLSQEYKRRSALLQLQAAQQLM 698
            |....:|.|.:.....   :.|.|..|..:..|:.:....:...||.|         ||||....
  Rat   625 GPLRRKAPQSLEMMAI---ESPPPSEPAAAECQSPKMTTFQDSELSGE---------LQAALSGP 677

  Fly   699 IETGSSPSKLLPTLSTPGYDYDDTVTVVPRCPAPSSGSLSSSISCSDHSLSHSTDYVEEFVSDVP 763
            .|.|::.:             :.:...:|..|..:|.. .||:|.....:|.|    :|.:.|.|
  Rat   678 AEAGAAAA-------------EKSSNHLPATPRTTSRQ-ESSLSGRARHMSSS----QELLGDGP 724

  Fly   764 FAGLLKGASQQLKEQPEVKLKIQEESKPQQTLPR-VR-------------PPIPTKP--AIPE-- 810
                 :|....:....|..|   :|.....|.|: ||             ||:|.||  .:|.  
  Rat   725 -----QGPGSPMSRSQEYLL---DEGPAPGTPPKEVRSSRHGHSVKRASVPPVPGKPRQVLPSGV 781

  Fly   811 KKFAKPPTTPTNQ---SLEANG--NSSSDVVIKP----------PRSPSKSPSKTSNK------- 853
            ..|. ||.|||..   |.:|.|  :..:...:||          |.||...|...:::       
  Rat   782 SHFT-PPQTPTKAQPGSPQALGGPHGPATAKVKPTPQLLPPTDRPMSPRSLPQSPTHRGFAYVLP 845

  Fly   854 SPVK------SPGKSPAKSPGSGHSAARNSINLLSPFNAEEAR-KKISEIIENFGSGILNTSITP 911
            .||:      :||..|...|     ||..::.|....:.|..| ||.:..:..:.:.        
  Rat   846 QPVEGEAGPPAPGPVPPPVP-----AAVPTLCLPPEADVEPGRPKKRAHSLNRYAAS-------- 897

  Fly   912 THDIELDFEDMEVPNERRELATRLRAAGLLHLERILFENGYDNYKFVNNVFEEPDIPLLHIPERD 976
              |.|.:.:::.||......||..|..|..|..|.  ..|.|  |.||........|....|...
  Rat   898 --DSEPERDELLVPAAAGPYATVQRRVGRSHSVRA--PAGTD--KNVNRSQSFAVRPRKKGPPPP 956

  Fly   977 APKLLRFVQSLPPAEFQPQVPVKTQQENKQMGVATLQQWLNTIALPEYLEFFNKHLYNTIESVCG 1041
            .||  |...::..|....:.....:.|:.::||...::..:.:|             .::::...
  Rat   957 PPK--RSSSAMASANLADEPSPDVETEDGRLGVRAQRRRASDLA-------------GSVDTGSA 1006

  Fly  1042 VWDVELQTVLEINKLGHRRRILQSLAYIRQMRDSDSKSQKTPLGENNETNQLTTNGNGTAREAPP 1106
            .....:..:||::.:|                                       |.|.|...||
  Rat  1007 GSVKSIAAMLELSSIG---------------------------------------GGGRAIRRPP 1032

  Fly  1107 R-----LPANP-----------VHHRNSI------TGYRKSRPAPPP---------PAPPARK-- 1138
            .     .||:|           |.|:.:|      ...|::...|..         |..||.:  
  Rat  1033 EGHPTPRPASPDPGRVATVLASVKHKEAIGPDGEVVNRRRTLSGPVTGLLATARRGPGEPAEQSH 1097

  Fly  1139 -----TAALQIRAPSELLLGL--PANLRTTEWRHSAQTLLNEHINYEVQYLGSTVVKELRGTEST 1196
                 ||..::|.|::...|:  |...|..                    ..:|:.:.:|..:|.
  Rat  1098 FMEDGTARQRLRGPAKGEAGVEGPPLARVE--------------------ASATLKRRIRAKQSQ 1142

  Fly  1197 KKSIQKLKTSAD 1208
            :::::.:.|.:|
  Rat  1143 QENVKFILTESD 1154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4393NP_001287483.1 Ank_2 <10..79 CDD:289560 24/80 (30%)
ANK 43..171 CDD:238125 59/136 (43%)
ANK repeat 49..79 CDD:293786 14/37 (38%)
Ank_2 53..148 CDD:289560 41/96 (43%)
ANK repeat 81..115 CDD:293786 14/35 (40%)
ANK 112..257 CDD:238125 64/145 (44%)
ANK repeat 117..148 CDD:293786 15/31 (48%)
Ank_2 122..233 CDD:289560 43/111 (39%)
ANK repeat 181..233 CDD:293786 17/52 (33%)
Ank_5 224..276 CDD:290568 31/52 (60%)
ANK repeat 237..267 CDD:293786 21/30 (70%)
SAM_AIDA1AB-like_repeat2 1005..1069 CDD:188899 6/64 (9%)
SAM 1009..1075 CDD:197735 5/66 (8%)
PTB_Anks 1161..1305 CDD:269972 5/49 (10%)
Caskin1XP_006245957.1 ANK 43..175 CDD:238125 59/142 (42%)
ANK repeat 56..86 CDD:293786 13/30 (43%)
Ank_2 60..152 CDD:289560 41/96 (43%)
ANK repeat 88..119 CDD:293786 14/35 (40%)
ANK 116..248 CDD:238125 64/145 (44%)
ANK repeat 121..152 CDD:293786 15/31 (48%)
Ank_2 126..225 CDD:289560 43/112 (38%)
ANK repeat 154..193 CDD:293786 17/48 (35%)
ANK repeat 195..225 CDD:293786 12/34 (35%)
Ank_5 215..268 CDD:290568 32/53 (60%)
ANK repeat 228..258 CDD:293786 21/30 (70%)
ANK repeat 260..294 CDD:293786 8/34 (24%)
SH3_Caskin1 291..352 CDD:212995 11/75 (15%)
Caskin1-CID 380..428 CDD:293208 12/70 (17%)
SAM 479..541 CDD:197735 10/78 (13%)
SAM_caskin1,2_repeat1 480..545 CDD:188896 12/81 (15%)
SAM_caskin1,2_repeat2 547..616 CDD:188897 11/83 (13%)
SAM 558..613 CDD:197735 8/66 (12%)
Caskin-Pro-rich 884..955 CDD:293512 19/85 (22%)
Caskin-tail 1375..1437 CDD:293238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0507
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.