DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and ECM14

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_012000.1 Gene:ECM14 SGDID:S000001174 Length:430 Species:Saccharomyces cerevisiae

Alignment Length:347 Identity:98/348 (28%)
Similarity:162/348 (47%) Gaps:68/348 (20%)


  Fly   154 QALIDANYLEVAPEDTKPEEFDWKRYHPLESINAWLKKLAETHPEVLLVE-LGVSAQGRPILGVQ 217
            ||:.:.:|           :|.:..|..|::|..||..|..:.|.::.|| ||.:.:||.:..:.
Yeast   107 QAVFENDY-----------DFFFNEYRDLDTIYMWLDLLERSFPSLVAVEHLGRTFEGRELKALH 160

  Fly   218 IAFD----NENRTTVFVESGIHAREWIAPATATYIIDQLVNSKDSAVQALARSQRWY-------I 271
            |:.:    |..:.|:.:..||||||||:.:|..:.:.||:|...|     ::.:..|       :
Yeast   161 ISGNKPESNPEKKTIVITGGIHAREWISVSTVCWALYQLLNRYGS-----SKKETKYLDDLDFLV 220

  Fly   272 FPTVNPDGYQYTFKGDRMWRKNRALFGI--CRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAAS 334
            .|..|||||.||:..||:|||||....:  |.|:|::.:|.|.|.  .|....|..:|||.:...
Yeast   221 IPVFNPDGYAYTWSHDRLWRKNRQRTHVPQCLGIDIDHSFGFQWE--KAHTHACSEEYSGETPFE 283

  Fly   335 EVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLA---ANKIK 396
            ..|.....::|.......:|..:|.:|||||.|::||.:|.:.:.  .||.::.:|:   :..|:
Yeast   284 AWEASAWYKYINETKGDYKIYGYIDMHSYSQEILYPYAYSCDALP--RDLENLLELSYGLSKAIR 346

  Fly   397 DVSGRIY-------KSGSIYETIYPSSGGSK----------DWAHGQLKIPITFSYELRGPADSE 444
            ..|||.|       ..||   .|:|..|...          .||. |||:..|.::.        
Yeast   347 SKSGRNYDVISACKDRGS---DIFPGLGAGSALDFMYHHRAHWAF-QLKLRDTGNHG-------- 399

  Fly   445 DLFILSAKEIEPTAAEAFASIQ 466
              |:|..:.|:|...|.:|:::
Yeast   400 --FLLPPENIKPVGKETYAALK 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 2/5 (40%)
M14_CP_A-B_like 179..472 CDD:199844 94/323 (29%)
ECM14NP_012000.1 M14_CP_A-B_like_1 118..425 CDD:199869 94/326 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I943
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 1 1.000 T634621
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 1 0.910 0.612 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.