DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and Cpa5

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_653120.1 Gene:Cpa5 MGIID:1921899 Length:436 Species:Mus musculus

Alignment Length:411 Identity:127/412 (31%)
Similarity:212/412 (51%) Gaps:19/412 (5%)


  Fly    78 QARYDHTRIYQVELASEEHVRLFQALE-QASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHS 141
            |..:...::.:|...:|:.:.|.:.|| |......|.....:|...:.:.|..:::......:.|
Mouse    34 QVNFTGDQVLRVLAKNEKQLSLLRDLETQKPQKVDFWRGPARPSLPVDMRVPFSELPSVKAYLKS 98

  Fly   142 YNVTHRVLNYNFQALIDANYLEVAPE---DTKPEEFDWKRYHPLESINAWLKKLAETHPE-VLLV 202
            :.:.:.::..:.|.|:|.....:|..   :.....|.:..||.|:.|.:|:......|.. |..:
Mouse    99 HGLAYSIMIKDIQVLLDEERDAMAKSRRLERSTNSFSYSSYHTLDEIYSWIDNFVAEHSNLVSKI 163

  Fly   203 ELGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNS--KDSAVQALAR 265
            .:|.|.:.|.||.::.:....||..:::::|||:||||..||..:|..::||:  ||..::.:..
Mouse   164 HIGKSFENRSILVLKFSTGGPNRPAIWIDTGIHSREWITHATGIWISQKIVNAYGKDHVLKRILN 228

  Fly   266 SQRWYIFPTVNPDGYQYTFKGDRMWRKNRA----LFGICRGVDLNRNFPFHWNVTGASGDPCRYD 326
            :...:|....||||:.:|...:|:||||::    :|  |.|||||||:...:...|::.:||...
Mouse   229 TMDIFIEIVTNPDGFAFTHSMNRLWRKNKSSQPGIF--CIGVDLNRNWKAGFGGNGSNKNPCSET 291

  Fly   327 YSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLA 391
            |.||:..||.|...:::||   ......:..||:||||||:|:|||||.|.|.|:.:|.::.|.|
Mouse   292 YRGPAPESEPEVAAIVDFI---TGHGNFKAMISIHSYSQMVMYPYGHSLEPVPNHEELFNLAKDA 353

  Fly   392 ANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKEIEP 456
            ...:..|.|..|..|||..|:|.:||.|.|||:.. .|...||:|||......  |:|.|.:|.|
Mouse   354 VKALNKVHGIQYIFGSISTTLYSASGISVDWAYDS-GIKYAFSFELRDTGQYG--FLLPASQIVP 415

  Fly   457 TAAEAFASIQTIVQEAGKRGY 477
            ||.|.:.::|||::......|
Mouse   416 TAEETWMALQTIMKHTLNHPY 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 13/72 (18%)
M14_CP_A-B_like 179..472 CDD:199844 110/300 (37%)
Cpa5NP_653120.1 Propep_M14 44..116 CDD:280416 13/72 (18%)
Peptidase_M14_like 134..434 CDD:299699 111/308 (36%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 196..199 2/3 (67%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 271..272 1/1 (100%)
Substrate binding. {ECO:0000250|UniProtKB:P00730} 324..325 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71100750
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.