DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and Cpa4

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_017177239.1 Gene:Cpa4 MGIID:1919041 Length:469 Species:Mus musculus

Alignment Length:397 Identity:123/398 (31%)
Similarity:206/398 (52%) Gaps:41/398 (10%)


  Fly    90 ELASEEHVRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQ 154
            ||.:.:|::|           |.........:.:.|:|....:......:.|..:.:.|...:.|
Mouse    91 ELVNSDHLKL-----------SVWKSPSTFDRPVDILVPSVSLLPVKSFLKSQGLDYSVTIEDLQ 144

  Fly   155 ALIDANYLEVAPED--TKPEEFDWKRYHPLESINAWLKKLAETHPE-VLLVELGVSAQGRPILGV 216
            ||:|....|:...:  .:..:|::..|||||:|...:..:|...|| |..|::|.:.:.||:..:
Mouse   145 ALLDNEDEEMQHNEGIERSGDFNYGAYHPLEAIYHEMDSIATDFPELVSRVKIGETFEKRPMYVL 209

  Fly   217 QIAF-DNENRTTVFVESGIHAREWIAPATATYIIDQLVN--SKDSAVQALARSQRWYIFPTVNPD 278
            :.:. ..:.|..:::.:||||||||:.|||.:...::|.  .||.|:.::.:....::.|..|||
Mouse   210 KFSTGGGKKRPAIWLNAGIHAREWISQATAIWTARKIVTDYKKDPAITSILKKVDIFLLPVANPD 274

  Fly   279 GYQYTFKGDRMWRKNRAL--FGICRGVDLNRNFPFHWNVT----GASGDPCRYDYSGPSAASEVE 337
            ||.||...:|:|||.|:.  ...|.|.|.|||    ||.:    |.|.:||...|.|....||||
Mouse   275 GYVYTQSQNRLWRKTRSRNPGSRCVGADPNRN----WNASFAGEGTSDNPCSEVYHGSHPNSEVE 335

  Fly   338 TQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGRI 402
            .:.:::||:   :....:.||.||||||::|:|||::.::..:..:|.|:.:.||..:..:||..
Mouse   336 VKSVVDFIQ---KHGNFKCFIDLHSYSQLLMYPYGYTVKKAPDAEELDDVARNAAQALASLSGTK 397

  Fly   403 YKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDL----FILSAKEIEPTAAEAFA 463
            |:.|....|:||:||.|.|||:.. .|...|::|||      |.    |:|.|.:|.|||.|.:.
Mouse   398 YRVGPTCTTVYPASGSSVDWAYDN-GIKYAFTFELR------DTGYYGFLLPASQIIPTAEETWL 455

  Fly   464 SIQTIVQ 470
            .::||::
Mouse   456 GLKTIME 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 13/69 (19%)
M14_CP_A-B_like 179..472 CDD:199844 108/307 (35%)
Cpa4XP_017177239.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69584050
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.