DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and Cpa4

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001102816.1 Gene:Cpa4 RGDID:1563619 Length:421 Species:Rattus norvegicus

Alignment Length:403 Identity:122/404 (30%)
Similarity:209/404 (52%) Gaps:30/404 (7%)


  Fly    85 RIYQVELASEEHVRLFQALEQASDSCSF-MGHARQPG---QKLTIMVTGAKVADFDDLVHSYNVT 145
            :::::.:.:.:.:|   .|.:..:|..| :...:.|.   :.:.|:|....:......:.|..:.
  Rat    25 QVFRINVRNGDEIR---KLTELVNSDHFKLNVWKSPSTFDRPVDILVPSVSLLPVKSFLKSQGLD 86

  Fly   146 HRVLNYNFQALIDANYLEVAPEDTKPE--EFDWKRYHPLESINAWLKKLAETHPEVL-LVELGVS 207
            :.|...|.|||:|....|:...:.:..  :|::..||..|:|...:..:|...|::. .|::|.:
  Rat    87 YSVTIDNLQALLDIEDEEMQHNEGRERSGDFNYGSYHSPEAIYHEMDSIATDFPDLASRVKIGET 151

  Fly   208 AQGRP--ILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVN--SKDSAVQALARSQR 268
            .:.||  :|........:.|..:::.:||||||||:.|||.:...::|.  .||.||.::.....
  Rat   152 FEKRPMYVLKFSTGGGGKKRPAIWLNAGIHAREWISQATAIWTARKIVTDYQKDPAVTSILEKMD 216

  Fly   269 WYIFPTVNPDGYQYTFKGDRMWRKNRAL--FGICRGVDLNRNFPFHWNVT----GASGDPCRYDY 327
            .::.|..|||||.||...:|:|||.|:.  ...|.|.|.|||    ||.:    |||.:||...|
  Rat   217 IFLLPVANPDGYVYTQNQNRLWRKTRSRNPGSRCIGADPNRN----WNASFAGEGASNNPCSEVY 277

  Fly   328 SGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAA 392
            .|....||||.:.:::||:   :....:.||.||||||::|:|||:|.::..:..:|.|:.:.||
  Rat   278 HGSHPNSEVEVKSVVDFIQ---KHGNFKCFIDLHSYSQLLMYPYGYSVKKAPDAEELDDVARSAA 339

  Fly   393 NKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKEIEPT 457
            ..:..:||..|:.|....|:||:||.|.|||:.. .|...|::|||......  |:|.|.:|.||
  Rat   340 KALASLSGTKYQVGPTCTTVYPASGSSVDWAYDN-GIKYAFTFELRDTGHYG--FLLPASQIIPT 401

  Fly   458 AAEAFASIQTIVQ 470
            |.|.:..::.|::
  Rat   402 AEETWQGLKVIME 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 14/75 (19%)
M14_CP_A-B_like 179..472 CDD:199844 106/304 (35%)
Cpa4NP_001102816.1 Propep_M14 28..99 CDD:280416 13/74 (18%)
Peptidase_M14_like 117..419 CDD:299699 107/309 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69584331
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.