DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and CG2915

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_610338.1 Gene:CG2915 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster

Alignment Length:465 Identity:247/466 (53%)
Similarity:322/466 (69%) Gaps:24/466 (5%)


  Fly    24 RIKMLPKGGTPKTWLLLLLVSSVCVIQESKASSFCTKADQCALDEEI-KTAADS-------VQAR 80
            :|..:|.......||::|     ||...:..::         ||..| ..|.||       .|||
  Fly     4 KIINMPAARIGTQWLVIL-----CVAMAASGTN---------LDSGICPVAGDSGCRGNPPDQAR 54

  Fly    81 YDHTRIYQVELASEEHVRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNVT 145
            ||:.|||.||..::|.:.|||.||:.|||.:|:||||:.||||:|:|...:|||..||:.:|.|.
  Fly    55 YDNYRIYNVEFENQEQIELFQKLEEQSDSLTFIGHAREVGQKLSILVAAHRVADIADLLKTYKVK 119

  Fly   146 HRVLNYNFQALIDANYLEVAPEDTKPEEFDWKRYHPLESINAWLKKLAETHP-EVLLVELGVSAQ 209
            ||||.||||..||.|..||.||.....:.||:.:..|::|..||.|:.|.:| .|.::::|.|.|
  Fly   120 HRVLTYNFQEKIDRNLAEVQPESIDASQLDWQHFFHLKTIYEWLDKMVEKYPNRVTVLDMGSSTQ 184

  Fly   210 GRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPT 274
            |..|.||::. .|.|...:|:||||||||||:||.|||||:||:.|:|..||.||:...|.|||.
  Fly   185 GNAIKGVKLT-SNANNKAIFIESGIHAREWISPAAATYIINQLLTSQDPKVQQLAQDYNWIIFPC 248

  Fly   275 VNPDGYQYTFKGDRMWRKNRALFGICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQ 339
            ||||||:|||:.||||||||.|||.|||||||||:|.|||.||:|.||.|||::||||.||:||:
  Fly   249 VNPDGYKYTFEHDRMWRKNRQLFGTCRGVDLNRNYPDHWNSTGSSSDPTRYDFAGPSAGSELETK 313

  Fly   340 RMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGRIYK 404
            |:|:|||.....|:|:|:|:|||||||:|||||::.|||.||.||.:.||.|:..||..:||.|.
  Fly   314 RLIDFIRANAGKEQIKTYIALHSYSQMLMFPYGYTKERVSNYDDLQEFGKKASAAIKAENGRDYV 378

  Fly   405 SGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKEIEPTAAEAFASIQTIV 469
            |||::||||||||||.||||.:..|||.:::|||||.||:|||||.|.||:|||:|||.:|:.||
  Fly   379 SGSLFETIYPSSGGSMDWAHSEAGIPIAYTFELRGPPDSQDLFILPAVEIQPTASEAFTAIRAIV 443

  Fly   470 QEAGKRGYYQ 479
            :.|.::|||:
  Fly   444 EAAAEKGYYK 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 39/71 (55%)
M14_CP_A-B_like 179..472 CDD:199844 176/294 (60%)
CG2915NP_610338.1 MpaA 50..433 CDD:225421 224/384 (58%)
Propep_M14 63..133 CDD:280416 39/70 (56%)
M14_CP_A-B_like 153..446 CDD:199844 176/294 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134639056
eggNOG 1 0.900 E1_COG2866
Homologene 1 1.000 H119965
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 1 0.900 OOG5_155072
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.