DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and CG4017

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_609309.1 Gene:CG4017 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster

Alignment Length:454 Identity:158/455 (35%)
Similarity:244/455 (54%) Gaps:49/455 (11%)


  Fly    38 LLLLLVSSVCVIQESKASSFCTKADQCALDEEIKTAADSVQARYDHTRIYQVELASEEHVRLFQA 102
            |||||:|...:|       ||....|                |:|:.::|:|.......:...::
  Fly     3 LLLLLLSVNILI-------FCLAERQ----------------RFDNYKVYRVSPVKANQLEGLRS 44

  Fly   103 LEQASDSCSFMGHARQPGQKLTIMVTGAKVA-DFD----DLVHSYNVTHRVLNYNFQALIDANYL 162
            ||..|:....:.:       |.:..|...|| |||    .||...:::..:::.|.|..:..:..
  Fly    45 LEANSEDALVLNN-------LHLGPTDFLVAPDFDGTFLKLVKDLDLSPELIDANAQTSLSLDIE 102

  Fly   163 EVAPEDTKPEEFDWKRYHPLESINAWLKKLAETHPEVLLVEL-GVSAQGRPILGVQIAFDNEN-- 224
            .:|..:.:.:::.|..||.|...:.|::.|...:|:|:.|.: |.|.:||.:||::|   |.|  
  Fly   103 PIADANRRSDDYSWSEYHELNDTHRWMQNLVGKYPDVVSVFVAGQSYEGRELLGLRI---NHNDG 164

  Fly   225 ---RTTVFVESGIHAREWIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPDGYQYTFKG 286
               :.::|:|:|:||||||.||||||..::|::|:...:..||||..|||.|..|||||.||.|.
  Fly   165 RAEKQSIFLEAGMHAREWIGPATATYFANELLSSQQQEIMNLARSYVWYILPHANPDGYVYTHKT 229

  Fly   287 DRMWRKNRA-LFGICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIRHRVE 350
            :|||||.|: ....|.|.|.|||:.|||...|||.|||...|:||.|.||.|.|.:.:|::.  .
  Fly   230 NRMWRKTRSPQDKNCVGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKS--V 292

  Fly   351 SERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPS 415
            .|.:..|:||||:||::::||||::...:|:..|..|...|...:|...|..|..|::|:.|||:
  Fly   293 PEPMFMFLSLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYPA 357

  Fly   416 SGGSKDWAHGQLKIPITFSYELRGPADS-EDLFILSAKEIEPTAAEAFASIQTIVQEAGK-RGY 477
            :|.|.|||:|.|.:..:|:||||....| ...|.|.|.:|.||..|...|:..:::.|.: .||
  Fly   358 AGSSMDWAYGVLNVKYSFTYELRPSGYSFWTGFRLPAAQIIPTGQETTDSLVEMIKAAAQIEGY 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 15/76 (20%)
M14_CP_A-B_like 179..472 CDD:199844 125/301 (42%)
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416 15/74 (20%)
M14_CP_A-B_like 119..415 CDD:199844 125/301 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71102887
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.