DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and CG7025

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_609133.2 Gene:CG7025 FlyBaseID:FBgn0031930 Length:429 Species:Drosophila melanogaster

Alignment Length:409 Identity:138/410 (34%)
Similarity:217/410 (53%) Gaps:25/410 (6%)


  Fly    80 RYDHTRIYQVELASEEHVRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNV 144
            |||:..:|:|:..::....:.:.|.:..::......|:   .:|.:|::.....:.:..:...||
  Fly    28 RYDNYSVYKVKFETQAQRSILRKLAEDRENFRLWHEAK---DELHLMLSPGAFGELETEIQKTNV 89

  Fly   145 THRVLNYNFQALID---ANYLEVAPEDTKPEEFDWKRYHPLESINAWLKKLAETHP---EVLLVE 203
            |..:...|.|.|||   |..|:.:.:.|    |.|.:|:.|..|.|||..:...:|   |..:| 
  Fly    90 TAELFISNVQELIDSEEAANLKASRDGT----FGWTKYNSLAEIYAWLDDILAAYPTITESFIV- 149

  Fly   204 LGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNSKDSAVQALARSQR 268
             |.|.:||.|.|::|:: ..|...|.:||.|||||||..||||::|::.:.|.|..|:.||.:..
  Fly   150 -GQSYEGRTIRGIKISY-KSNNPGVLIESNIHAREWITSATATWLINEFLTSTDELVRDLAENHD 212

  Fly   269 WYIFPTVNPDGYQYTFKGDRMWRKNR--ALFGICRGVDLNRNFPFHW-NVTGASGDPCRYDYSGP 330
            |||.|.:|.||:.||.:.||||||.|  :....|.|.|.|||:..|| ...|||.:||..||.||
  Fly   213 WYIVPVLNVDGFVYTHEKDRMWRKTRQPSEISSCIGADPNRNYDSHWMENEGASSNPCAEDYGGP 277

  Fly   331 SAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERV-DNYHDLTDIGKLAANK 394
            ...||.|.|.|.||:..  ..::|...::.|||||:::.||||:.|.. .|:.|:.::.|...:.
  Fly   278 KPFSEPEIQAMSEFVIS--IKDKINVLLAFHSYSQLLLSPYGHTKEEFPPNFDDMMEVAKAYGDA 340

  Fly   395 IKDVS-GRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKEIEPTA 458
            ::.:. |.:|:.||....:||:||.:.|||:.:..:.|:::.|.|......  |||....|.|.|
  Fly   341 VESLPYGTVYRYGSAAGILYPASGATIDWAYNEQGVEISYTIEFRDTGRYG--FILPPVHIIPNA 403

  Fly   459 AEAFASIQTIVQEAGKRGY 477
            .||...|..::::....||
  Fly   404 EEALIGIAALLEKCKDLGY 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 13/74 (18%)
M14_CP_A-B_like 179..472 CDD:199844 114/301 (38%)
CG7025NP_609133.2 Propep_M14 36..103 CDD:280416 12/70 (17%)
M14_CP_A-B_like 123..416 CDD:199844 114/300 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71041323
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.