DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and CG8945

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_573190.1 Gene:CG8945 FlyBaseID:FBgn0030815 Length:1430 Species:Drosophila melanogaster

Alignment Length:509 Identity:141/510 (28%)
Similarity:238/510 (47%) Gaps:85/510 (17%)


  Fly    34 PKTWLLLL---LVSSVCVIQESKASSFCTKADQCALDEEIKTAADSVQAR--------YDHTRIY 87
            |:.|:.:|   :|:|......:..|:...:|....:.....|:..:..:|        ||..:|:
  Fly   923 PQNWIGILAHHIVNSTGSAISTSTSNPLLQALATRMTTRGTTSTTTTTSRPDVPRRISYDKYQIW 987

  Fly    88 QVELASEEHVRLFQALEQASDSCSFMGHARQPGQKLT-IMVTGAKVADFDDLVHSYNVTHRVLNY 151
            :::...||.||..:..::..|............:.|| ::|....:.||...::...:.|.||.:
  Fly   988 RLKPQDEEQVRALEEFKKGEDGVKLQWLKGPSLRGLTDVLVPPKMLVDFQGTLNYEGIAHEVLIF 1052

  Fly   152 NF-----QALIDANYLEVA----PEDTKPEEFDWKRYHPLESINAWLKKLAETHPEVL-LVELGV 206
            :.     ..|...:||:..    |..|.|....|.|||..:.|..:|:.:...||::: |:.:|.
  Fly  1053 DVGKAIAYELTKEDYLQTTRPSKPRPTAPPPMTWNRYHNHDEIVKYLETVRMRHPQLVELIHIGR 1117

  Fly   207 SAQGRPILGVQI-------AFDNENRTT---------------VFVESGIHAREWIAPATATYII 249
            |.:|||::.|:|       |.:|:...|               ||||:|.....||.||.||::|
  Fly  1118 SFEGRPLIVVKIESKQTAAAANNDGLHTIKRPKRKRKSGQANAVFVEAGAQGLAWIGPAAATWMI 1182

  Fly   250 DQLV-----NSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALF------------ 297
            .:|:     |..:..|:.: |:..|||.|.:|||||.|:.:.||.|:|:|:..            
  Fly  1183 AELLRLMKTNKSNEDVEFI-RNTTWYIMPVLNPDGYAYSHEYDRFWKKSRSQHQTPPPSGLLDSA 1246

  Fly   298 -----------GICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIR-HRVE 350
                       .:|.||||:||:.:||...|:|..||...|:||:..||.||:.:.||:. :|.:
  Fly  1247 MTWLQQKRGPDKVCYGVDLDRNWLYHWGKRGSSKAPCNEFYAGPAPFSEPETKAVSEFLMDYRTQ 1311

  Fly   351 SERIRTFISLHSYSQMIMFPY----GHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYET 411
               |:.:|||.:|.|:|.:|.    ..::||:|::.|:..:|.....| |....| ||..:..:.
  Fly  1312 ---IKLYISLQAYGQVISYPVKANSTFNSERLDDFLDVAMVGTDGLRK-KGSKSR-YKVDASNDL 1371

  Fly   412 IYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKEIEPTAAEAFASI 465
            |...||.:..:|..::.||  |||.|:...:....::|.:..|||||.:||..|
  Fly  1372 IEQRSGCADAFAAYEIGIP--FSYTLQLADNGVHGYLLPSSAIEPTARDAFEII 1423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 14/77 (18%)
M14_CP_A-B_like 179..472 CDD:199844 108/344 (31%)
CG8945NP_573190.1 Propep_M14 988..1058 CDD:280416 13/70 (19%)
M14_CP_A-B_like 1089..1430 CDD:199844 108/344 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.