DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and Cpa6

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_008761718.2 Gene:Cpa6 RGDID:1311764 Length:438 Species:Rattus norvegicus

Alignment Length:408 Identity:126/409 (31%)
Similarity:206/409 (50%) Gaps:29/409 (7%)


  Fly    83 HTRIYQVELASEEHVRLFQALEQASDSCSFMGHAR-----QP--------GQKLTIMVTGAKVAD 134
            |...|....|..:.:||....|:.:.:...:.|..     ||        |....:.||......
  Rat    29 HCHSYDNRYAGHKVIRLIPKSEEEALALKSVSHQLKVDLWQPSSISYVSEGTITDVRVTQNASRT 93

  Fly   135 FDDLVHSYNVTHRVLNYNFQ-ALIDANYLEVAPEDTKPEEFDWKRYHPLESINAWLKKLAETHPE 198
            ...::...|:.::||..:.| |:.:.|.:..........|::::.||.||.|.:|:..|.:|.|.
  Rat    94 LLAILQETNIQYKVLIEDLQKAVENENSVHTQRNRRSLSEYNYEVYHSLEDIQSWMHHLNQTQPG 158

  Fly   199 VLLV-ELGVSAQGRPILGVQIAFDNE-NRTTVFVESGIHAREWIAPATATYIIDQ--LVNSKDSA 259
            ::.| .:|.|.:||.:|.:|:...:: .:..|:::.||||||||.||...:.:.:  |....|.|
  Rat   159 LVRVFPIGRSFEGRSLLIIQLGRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVKEAILTYKTDPA 223

  Fly   260 VQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFG--ICRGVDLNRNFPFHWNVTGASGDP 322
            ::.:.....:||.|.:|.|||.:::..||.|||.|:...  .|||||.|||:...|...|||.||
  Rat   224 MRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDANRNWKVKWCDEGASADP 288

  Fly   323 CRYDYSGPSAASEVETQRMIEFIR-HRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTD 386
            |...|.||...||.|.:.:..|:| ||   :|||.::|.|:|:||:::||.:....:.|:..:..
  Rat   289 CDDTYCGPFPESEPEVKAVANFLRKHR---KRIRAYLSFHAYAQMLLYPYSYKHATIPNFSCVEF 350

  Fly   387 IGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDL-FILS 450
            ....|...::.|.|..|:.|...:|:|.|||.|.|||: :..||.:|::|||   |:... |:|.
  Rat   351 AAHKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAY-KNGIPYSFAFELR---DTGYFGFLLP 411

  Fly   451 AKEIEPTAAEAFASIQTI 468
            ...|:||..|...:::.|
  Rat   412 EMLIKPTCTETMLAVKNI 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 15/85 (18%)
M14_CP_A-B_like 179..472 CDD:199844 107/299 (36%)
Cpa6XP_008761718.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70257404
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.