DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and W01A8.6

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_492003.2 Gene:W01A8.6 WormBaseID:WBGene00012168 Length:380 Species:Caenorhabditis elegans

Alignment Length:331 Identity:94/332 (28%)
Similarity:152/332 (46%) Gaps:43/332 (13%)


  Fly   174 FDWKRYHPLESINAWLKKLAETHPE-VLLVELGVSAQGRPILGVQI---AFDNENRTTVFVESGI 234
            ||...|:.......::|.:|..:|. |.|..:|.:.:|||:|||:|   |...:.:..|:::.|.
 Worm    30 FDLTVYNDWPQFEDYIKGVAHDNPSFVQLKTIGRTREGRPLLGVRIGKPALPGKRKIAVWLDGGN 94

  Fly   235 HAREWIAPATATYIIDQLVNS--KDSAVQALARSQRWYIFPTVNPDGYQYTFKGD----RMWRKN 293
            |||||.|...|.|.|::|||.  .|..:.....:...|:||.:||||:.|:....    |.||||
 Worm    95 HAREWPAFHVAVYFIEKLVNGYLSDDKITKYVETLDIYVFPVLNPDGFVYSRTSTRAMIRQWRKN 159

  Fly   294 RALFG-----------ICRGVDLNR---------NFPFHWNVTGASGDPCRYDYSGPSAASEVET 338
            ||...           .|.||||||         |:||:        :||..::.||...||.||
 Worm   160 RAPENCTGTGPFQTDICCEGVDLNRNYDIGFSHKNYPFN--------NPCSDEFQGPRPFSEPET 216

  Fly   339 QRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERV-DNYHDLTDIGKLAANKIKDVSGRI 402
            :.:.:||.......|:...:|:|::.|:.:.||.:..... .:..||..:...||:::.......
 Worm   217 RAVRDFIMSSEIYGRLYALVSMHTHGQLWILPYNYQKRTYPQDIKDLEILANRAADRVFAYRETK 281

  Fly   403 YKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKE--IEPTAAEAFASI 465
            |:.|:..:.:..::||:.||.  :...|..:.|.|..|.|.:..|....|.  :.|...|.:..|
 Worm   282 YRVGTAADMLGTATGGATDWI--KKNTPTKYVYVLELPPDMKTWFAFQVKPHWLIPIGKETWLGI 344

  Fly   466 QTIVQE 471
            :.|..:
 Worm   345 EVIFDQ 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 92/327 (28%)
W01A8.6NP_492003.2 M14_CP_A-B_like 35..351 CDD:199844 92/327 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.