DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and ZC434.9

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001251356.1 Gene:ZC434.9 WormBaseID:WBGene00013895 Length:720 Species:Caenorhabditis elegans

Alignment Length:483 Identity:148/484 (31%)
Similarity:239/484 (49%) Gaps:80/484 (17%)


  Fly    37 WLLLLLVSSVCVIQESKASSFCTKADQCALDEEIKTAADSVQARYDHTRIYQVELASEEHVRLFQ 101
            |||:|:            |:|       |::.||   ||....::...|.:..::...:.:|  .
 Worm    11 WLLILI------------SAF-------AINAEI---ADDKPPKFQVLRAHATDVPQLKALR--D 51

  Fly   102 ALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQALIDANYLEVAP 166
            ..|:......|.....:.|.:..|||...::...|.::.:.|:::.|:      :.|...|.:..
 Worm    52 IHERTQHDLDFWQTPSKVGHRADIMVDEDRMEWLDSVLKNSNISYDVI------IEDVGKLILEK 110

  Fly   167 EDTKPE------------------EFDWKRYHPLESINAWLKKLAETHPEVLLV-ELGVSAQGRP 212
            |...|.                  .:.:..||..::|..|:|.:...:|:...| .:|.:::|||
 Worm   111 EHGPPRFSNLLFSKRMHNEGGNRARYGFGEYHSYQTICDWMKDIERKYPDKAKVFTMGTTSEGRP 175

  Fly   213 ILGVQI---AFDNENRTTVFVESGIHAREWIAPATATYIIDQLV--NSKDSAVQALARSQRWYIF 272
            |.|::|   .:.|:.| ..:::.|||||||.|..||.:.||:|:  .:.||.|:|......:||.
 Worm   176 IQGIKIGSQVWRNDKR-IFWIDGGIHAREWAAVHTALWFIDRLIADYNDDSLVRAAVDRLNFYIL 239

  Fly   273 PTVNPDGYQYTFKGD-----RMWRKNRALFGI------------CRGVDLNRNFPFHWNVTGASG 320
            |..|||||:|: :.|     |:||||||  |:            |.|||||||:.:|:..||:|.
 Worm   240 PVANPDGYEYS-RSDVSPMIRLWRKNRA--GVVCKKDRWFRDRCCGGVDLNRNYDWHFGETGSST 301

  Fly   321 DPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVD-NYHDL 384
            |.|...|.|.||.||.||:.|.:|:.....:.:|..||:||:||||.:.||.|:.:.|. :..:|
 Worm   302 DKCSEIYQGSSAFSESETRSMRDFLTSSELNGKIDAFITLHTYSQMWIHPYSHARKSVPADVAEL 366

  Fly   385 TDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFIL 449
            ..:|:.|...:::..|..||.|:..:.:|||:|||.|||.|.|:|...:..|||...|..|.|||
 Worm   367 QRVGRAAVAALENTYGTKYKFGTGSDILYPSAGGSDDWAKGTLRIKYVYLLELRPGEDVWDGFIL 431

  Fly   450 SAKEIEPTAAEAFASIQTIV----QEAG 473
            ...::.|||.|.:..|:.::    ::||
 Worm   432 DQHQLIPTAKETWNGIKVVIRAVTEQAG 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 11/71 (15%)
M14_CP_A-B_like 179..472 CDD:199844 120/321 (37%)
ZC434.9NP_001251356.1 Propep_M14 37..107 CDD:280416 13/78 (17%)
M14_CP_A-B_like 141..454 CDD:199844 120/317 (38%)
ShK 682..719 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.