DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and Y47G6A.19

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001021762.2 Gene:Y47G6A.19 WormBaseID:WBGene00021645 Length:506 Species:Caenorhabditis elegans

Alignment Length:418 Identity:137/419 (33%)
Similarity:213/419 (51%) Gaps:58/419 (14%)


  Fly    97 VRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQ-ALIDAN 160
            :|||:..:  :|...|..........:.|||    ..:..|....|...|   .|.|| |:.|.:
 Worm    40 IRLFETAD--TDRADFWHAPSVVNGTVDIMV----APEHTDQFRQYLEKH---GYTFQVAIDDLH 95

  Fly   161 YLEVAPE-----DTKPEEFDWKR---------------YHPLESINAWLKKLAETHPEVL-LVEL 204
            .|.:..|     .:..:.|..||               |:....::.||:::||..|::. |:::
 Worm    96 KLLIEKEGNLSTHSNDDAFFLKRLHDDVGFHSRLRMGEYYSYSVLSTWLERIAENMPDIAKLIKV 160

  Fly   205 GVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNSK--DSAVQALARSQ 267
            |.:.:||.|||::...|..::..|.:::|||||||.|..||:|.|:.:||.:  |..:|....:.
 Worm   161 GTTIEGRDILGLKFGKDTPDKKIVVIDAGIHAREWAAIHTASYFINLIVNGREEDPQIQNYLDNI 225

  Fly   268 RWYIFPTVNPDGYQYTFKGD------RMWRKNR-----ALFGI----CRGVDLNRNFPFHWNVTG 317
            ..||.|.:|||||:|| :.|      |||||:|     |..|:    |.||||||||.|.::..|
 Worm   226 VLYIIPVLNPDGYEYT-RTDKTNPRARMWRKSRSPKACAFDGVRNSCCMGVDLNRNFDFRFSEIG 289

  Fly   318 ASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNY- 381
            ||..||...|.||||.||.|::...:|:...  ..|:..:|:||||||:.::.|.|   |...| 
 Worm   290 ASRYPCSEIYHGPSAFSEPESKAYSQFLTSL--KGRLEAYITLHSYSQLWIYSYSH---RKFTYA 349

  Fly   382 HDLTDIGKLAANKIKDVS---GRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADS 443
            .|:.:..::||..::::.   |..|:.|:..|.||..||||.|||...|||..:::.|||...:.
 Worm   350 PDIEETRRVAAKAVQELGRMYGTKYRHGTGPEIIYAFSGGSTDWAKETLKIKYSYTIELRPGYEE 414

  Fly   444 EDLFILSAKEIEPTAAEAFASIQTIVQE 471
            .:.|:|...::.|||.|.:|.:..::.|
 Worm   415 WNGFVLDKNQLIPTAKETWAGVTVVLDE 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 16/63 (25%)
M14_CP_A-B_like 179..472 CDD:199844 116/316 (37%)
Y47G6A.19NP_001021762.2 Propep_M14 27..98 CDD:280416 17/67 (25%)
M14_CP_A-B_like 134..443 CDD:199844 116/316 (37%)
ShK 464..501 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I2086
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.