DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and LOC100490370

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_017953133.1 Gene:LOC100490370 ID: Length:452 Species:Xenopus tropicalis

Alignment Length:418 Identity:124/419 (30%)
Similarity:218/419 (52%) Gaps:43/419 (10%)


  Fly    81 YDHTRIYQVELASEEHVR------------LFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVA 133
            ||...|.::...||:.|:            |.:.|:....:.....|.|.|...|.::.      
 Frog    24 YDGGNILEITPESEKQVQCLQNILQSWLLDLLKPLQPEDINVKTTVHVRIPSTALQLVK------ 82

  Fly   134 DFDDLVHSYNVTHRVLNYNFQALIDANYLEVAPEDTKP-----EEFDWKRYHPLESINAWLKKLA 193
              :||:|. :.:..:|..|      ..|:|....|||.     .|:::..|||:..|..|:..:|
 Frog    83 --EDLLHC-SQSLEILTGN------VKYIEEDKTDTKETRKTINEYNYTTYHPMNEIYDWINGIA 138

  Fly   194 ETHPEVLLVE-LGVSAQGRPILGVQIAFDNEN-RTTVFVESGIHAREWIAPATATYIIDQLVNS- 255
            :.|.:.:... ||::.:.||:..::|:..:|| :..|:::.|||||||||||...:.:.::|.: 
 Frog   139 KKHSQFVTQHLLGLTYESRPMQYLKISQPSENHKKIVWIDCGIHAREWIAPAFCQWFVKEIVQNY 203

  Fly   256 -KDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALF--GICRGVDLNRNFPFHWNVTG 317
             .|..::.:.::...|:.|.:|.|||.|::..:|:|||||:.:  |.|.||||||||...|....
 Frog   204 QNDQRIRKILQNLDIYVLPVLNIDGYIYSWTKERLWRKNRSQYGNGTCYGVDLNRNFNVSWCTHR 268

  Fly   318 ASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYH 382
            :|.:.....:.|.|..||.||:.::||:..|  ...|..|:::|||||:|:..||:|.....|.:
 Frog   269 SSTNCSSNSFCGSSPVSEPETRAVVEFVESR--KADIVCFLTMHSYSQLILTAYGYSTGLSRNSN 331

  Fly   383 DLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLF 447
            ::..:.::||:.::.:.|..|::|...:.:|.:||.|:||.| .|.|..:|::|||.  :....|
 Frog   332 EIFKVAEMAASAMEKIHGTKYRAGPFSKLLYEASGTSQDWVH-DLGIDFSFTFELRD--NGSHKF 393

  Fly   448 ILSAKEIEPTAAEAFASIQTIVQEAGKR 475
            .|...:|:||..|..|.:.||::...::
 Frog   394 TLPEDQIQPTCEETMAGVMTIIEYVNEK 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 14/83 (17%)
M14_CP_A-B_like 179..472 CDD:199844 101/299 (34%)
LOC100490370XP_017953133.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H119965
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.