DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and cpo

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio

Alignment Length:307 Identity:106/308 (34%)
Similarity:180/308 (58%) Gaps:14/308 (5%)


  Fly   172 EEFDWKRYHPLESINAWLKKLAETHPEVL-LVELGVSAQGRPILGVQIAFDNEN-RTTVFVESGI 234
            :.:|:.:||.::.|:||:.::...:|:|: .:..|.:.:.|.|..::|.|.:.. :..::::.||
Zfish    28 KSYDYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTTPKKAIWMDCGI 92

  Fly   235 HAREWIAPATATYIIDQLVNS--KDSAVQALARSQRWYIFPTVNPDGYQYTF--KGDRMWRKNRA 295
            |||||||||...:.:.:::.|  .||.|..|.::..:||.|.:|.|||.|::  ...|:|||:|:
Zfish    93 HAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRS 157

  Fly   296 LF---GICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTF 357
            ..   ..|.|.||||||..:|.:.|.|.:.|...|:|.:|.||.|.:.:.:|:  ......:..:
Zfish   158 PCHENSTCSGTDLNRNFYANWGMVGISRNCCSEVYNGATALSEPEAEAVTDFL--GAHQNHLLCY 220

  Fly   358 ISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDW 422
            :::|||.|:|:.||||......||.:|.::|..||..||.|.|:.||.||..:.:||:||.|:|:
Zfish   221 LTIHSYGQLILVPYGHPNISAPNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDF 285

  Fly   423 AHGQLKIPITFSYELRGPADSEDLFILSAKEIEPTAAEAFASIQTIV 469
            |. .:.||.:|::|||.  :.:..|||...:|:||..||:....:|:
Zfish   286 AR-LIGIPYSFTFELRD--EGQHGFILPEDQIQPTCQEAYEGAMSII 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 105/301 (35%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 105/301 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70538203
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.